Planctomyces sp. SH-PL14: VT03_29800 Help Entry VT03_29800        CDS       T04354                                  Symbol acpP_3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pls  Planctomyces sp. SH-PL14 Pathway pls01100   Metabolic pathways pls01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pls00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VT03_29800 (acpP_3)    00074 Mycolic acid biosynthesis     VT03_29800 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VT03_29800 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Ribosomal_L12_N Ribosomal_L50 MoCoBD_2 Motif Other DBs NCBI-ProteinID:  AMV22135 LinkDB All DBs Position complement(7631869..7632111) Genome browser AA seq 80 aa AA seqDB search MSQSLEEKVIAIVSEQLSVPVEEIKLESNFIDDLKADSLDIVELGMAFEDKFGVSIPDED YEKLKTVGDAVSYIKQRGNA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgtcgcagagtcttgaggagaaagtcatcgccattgtgagcgagcagctcagcgtgccg gtggaagagatcaagctggaaagcaacttcatcgatgatctcaaggccgattcgctcgac atcgtcgaactgggcatggctttcgaagacaagttcggtgtgagcattccggacgaagac tacgaaaagctgaagacggtcggagacgccgtcagctacatcaagcagcgagggaacgcg taa

DBGET integrated database retrieval system