Pelodictyon luteolum: Plut_0805
Help
Entry
Plut_0805 CDS
T00291
Name
(GenBank) transcriptional regulator, AraC family
KO
K18954
AraC family transcriptional regulator, transcriptional activator of pobA
Organism
plt
Pelodictyon luteolum
Brite
KEGG Orthology (KO) [BR:
plt00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
plt03000
]
Plut_0805
Transcription factors [BR:
plt03000
]
Prokaryotic type
Helix-turn-helix
AraC family
Plut_0805
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HTH_18
HTH_AraC
AraC_binding
Motif
Other DBs
NCBI-ProteinID:
ABB23676
UniProt:
Q3B4Q5
LinkDB
All DBs
Position
924250..925167
Genome browser
AA seq
305 aa
AA seq
DB search
MFTALDALTNLFNSGSALKRDHDIPVSRLENSFFEIVRLSDLDASMKRPNHRHDFFKILW
FTSSSDAAHFIDFESYPAESGLIYLIAPGQVHAYEGLSGSGYAIVFSLDLFSSIQNPRLR
LMFNPFMNRGIPSGSDEAGVLRQLAELMVLESGGKKDFFILLSYVEAFLRHIARMHSEAS
FVLTKAGERMGKLFALVDGSFRSERRSDFYASALGITPKRLNEILNERFGTTLTRILHRR
LILEAKREVAYGRKSFKEIAFELGFSDQAYFSRFFKAQAGMMPADFRRTMASGPGGAMPK
DAGGS
NT seq
918 nt
NT seq
+upstream
nt +downstream
nt
atgtttacagcattggatgcattgaccaaccttttcaactccggaagtgcattgaagcgt
gatcatgacataccggtcagcaggctggagaacagtttctttgaaatcgtccggctctcc
gacctggatgcttcgatgaagcggccgaaccaccggcacgactttttcaagatcctctgg
ttcacctccagcagtgatgcggcgcatttcattgatttcgaatcctatcctgccgaatcg
ggactgatctacctgattgcccccggtcaggtgcatgcctatgaaggactttccggtagc
ggctacgccatcgttttttcacttgacctgttcagcagcatccagaacccccggctcagg
ctcatgttcaacccgttcatgaaccggggcatcccgtccgggagcgacgaggccggcgtt
ctccgccagcttgccgaactgatggtactggaatccggaggaaagaaagattttttcatt
cttctgtcgtatgttgaagcatttttgcgccatattgcacgcatgcacagcgaggcgtca
ttcgtcctgacaaaggcaggggagcgcatgggtaaactttttgctctcgttgacggtagt
ttccgcagcgagcgccgctcggatttttacgcttctgcgctcggtatcaccccgaaacgc
ctgaacgagatcctcaacgaacgcttcggcacgacccttacccggatcctgcaccggcgg
ctgatccttgaagcaaaaagggaggttgcctacgggaggaagagtttcaaggagatcgcc
tttgaactgggcttcagcgaccaggcctacttcagcaggttcttcaaggcgcaggccggc
atgatgccggcggacttccggaggaccatggcctcgggtcccggcggtgccatgccgaaa
gatgctggaggatcatga
DBGET
integrated database retrieval system