Pseudoduganella lutea: EWM63_22125 Help Entry EWM63_22125       CDS       T10124                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plue  Pseudoduganella lutea Pathway plue01100   Metabolic pathways plue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plue00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EWM63_22125    00074 Mycolic acid biosynthesis     EWM63_22125   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EWM63_22125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 MAP DUF1493 Motif Other DBs NCBI-ProteinID:  QBE65355 UniProt:  A0A4P6L283 LinkDB All DBs Position 5174302..5174541 Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKNESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYATNHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgatatcgaacaacgcgttaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgacatcaagaacgaatcgtctttcgtcgatgacctgggcgccgattccctcgacacc gttgaactggtaatggcactggaagacgagttcgagatggaaatccctgacgaacaagct gaaaagatcaccaccgtgcagcaggctatcgactacgcgaccaaccacgtcaaggcctaa

DBGET integrated database retrieval system