Candidatus Phytoplasma luffae: LFWB_3640 Help Entry LFWB_3640         CDS       T07569                                  Symbol himA Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pluf  Candidatus Phytoplasma luffae Brite KEGG Orthology (KO) [BR:pluf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pluf03032]     LFWB_3640 (himA)    03036 Chromosome and associated proteins [BR:pluf03036]     LFWB_3640 (himA)    03400 DNA repair and recombination proteins [BR:pluf03400]     LFWB_3640 (himA) DNA replication proteins [BR:pluf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LFWB_3640 (himA) Chromosome and associated proteins [BR:pluf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LFWB_3640 (himA) DNA repair and recombination proteins [BR:pluf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LFWB_3640 (himA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Motif Other DBs NCBI-ProteinID:  QTX02934 UniProt:  A0A975FJK7 LinkDB All DBs Position complement(377204..377494) Genome browser AA seq 96 aa AA seqDB search MTKKELIKTIAVMHKTSVTQTQDFYNSFENALIKAITSNEEVVLSPSIGKFILKSRKARV GRNPQTGKKLKIPTKTVVNFKLSKTIKDEVKNLKLK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacaaaaaaagaattaatcaaaactatcgcagtaatgcataaaacttcggttactcaa acccaagatttttacaactcgttcgaaaatgctttaatcaaagcaatcacatccaacgaa gaagtggtattatcaccttcaattggcaaattcatcttaaaatcaagaaaagcccgcgtg ggaagaaacccccaaacaggtaaaaaactcaaaatccctacaaaaactgtggtaaatttt aaactttctaaaactattaaagatgaagtcaaaaaccttaaattaaaataa

DBGET integrated database retrieval system