Photorhabdus luminescens: CE143_09375 Help Entry CE143_09375       CDS       T08000                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism plui  Photorhabdus luminescens Brite KEGG Orthology (KO) [BR:plui00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:plui03400]     CE143_09375 DNA repair and recombination proteins [BR:plui03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     CE143_09375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI LPD29 Motif Other DBs NCBI-ProteinID:  UJD75136 LinkDB All DBs Position 2147293..2147529 Genome browser AA seq 78 aa AA seqDB search MHVEVTIDKSKKLPKGAVPALAEELDNRLRRRWPDIKTNVKLASHDGLSVRGGNLDDRKA VEEILQETWESADDWFQP NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcatgtagaagtcactatcgataagtctaaaaaactgccaaaaggtgctgtccctgcg cttgctgaagaactggataaccgtcttagacgtcgatggcctgatattaaaaccaatgta aagctggcaagccatgatgggctatctgttcgtggcggcaatcttgatgacaggaaagcc gttgaagagattctacaggagacatgggaaagcgctgatgattggttccagccctga

DBGET integrated database retrieval system