Photorhabdus luminescens: CE143_11340 Help Entry CE143_11340       CDS       T08000                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plui  Photorhabdus luminescens Pathway plui01100   Metabolic pathways plui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CE143_11340    00074 Mycolic acid biosynthesis     CE143_11340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CE143_11340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF4029 Motif Other DBs NCBI-ProteinID:  UJD75483 LinkDB All DBs Position 2566866..2567111 Genome browser AA seq 81 aa AA seqDB search MPTQNDIFTKIKNRILVMKDIEEEEITPESSFVSLKFDSLDYVEIQVFVLEVYGISIKAE IFSNHSILTLNELTNYIESNL NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgccaacacaaaatgatatttttactaagataaagaatagaatattagtgatgaaggat atcgaagaggaggaaataacaccagaatcttcttttgtttcgcttaaatttgatagcctt gactatgtggaaattcaggtttttgtattggaggtgtatggtattagtattaaagctgag attttttcaaatcattctattttaacattaaatgaacttacgaattatatagagtctaat ttataa

DBGET integrated database retrieval system