Photorhabdus luminescens: CE143_14465 Help Entry CE143_14465       CDS       T08000                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plui  Photorhabdus luminescens Pathway plui01100   Metabolic pathways plui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CE143_14465    00074 Mycolic acid biosynthesis     CE143_14465   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CE143_14465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Ribosomal_L50 DUF6137 Motif Other DBs NCBI-ProteinID:  UJD76038 LinkDB All DBs Position complement(3347345..3347581) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEEEVVNSASFVDDLGADSLDTVELVMALEEEFDIEIPDEEA EKITTVQAAIDYVQNQSE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactattgaagaacgcgttaaaaaaatcatcgttgaacaacttggtgttaaagag gaagaggttgttaattcagcttcttttgtagatgacttgggcgctgattctcttgacaca gttgaactggtaatggctctggaagaagagttcgatatcgaaattccagatgaagaagca gaaaagatcactacagttcaggcagctattgattacgtccagaaccaaagcgaataa

DBGET integrated database retrieval system