Photorhabdus luminescens: CE143_23670 Help Entry CE143_23670       CDS       T08000                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism plui  Photorhabdus luminescens Pathway plui01100   Metabolic pathways plui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CE143_23670    00074 Mycolic acid biosynthesis     CE143_23670   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CE143_23670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding pP_pnuc_2 DUF7080 Motif Other DBs NCBI-ProteinID:  UJD77688 LinkDB All DBs Position 5480859..5481095 Genome browser AA seq 78 aa AA seqDB search MKLFELLQSQITELTDIEPEDITLDTLLDDIHLVSLDFVSIQVALKREMGIQLNFDKFQR DNTTTIGDFVNYVSELAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaaactatttgaattacttcaatctcaaattactgaattaactgatatcgaaccagaa gatattactcttgacactctacttgatgatattcatttagtgagtctggatttcgtttct attcaggttgctttaaaaagagaaatgggcattcaactgaatttcgataagttccaacga gacaacacaacgacaatcggtgattttgtcaattatgtcagtgaattagcaaaataa

DBGET integrated database retrieval system