Pseudomonas luteola: FOB45_18330 Help Entry FOB45_18330       CDS       T06601                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plul  Pseudomonas luteola Pathway plul01100   Metabolic pathways plul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FOB45_18330 (acpP)    00074 Mycolic acid biosynthesis     FOB45_18330 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FOB45_18330 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QEU29613 LinkDB All DBs Position 1:complement(2364033..2364269) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaagaa gaggaagtaaccaacagcgcttccttcgtcgaggatctgggcgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgaaactgaaatcccggacgaacaagcc gaaaagatcaccactgttcaggaagctatcgactacatcgttgctcaccagcaataa

DBGET integrated database retrieval system