KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_16655
Entry
A4R40_16655       CDS       T05478                                 
Symbol
rnc
Name
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:plum00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    A4R40_16655 (rnc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:plum03019]
    A4R40_16655 (rnc)
   03009 Ribosome biogenesis [BR:plum03009]
    A4R40_16655 (rnc)
   03036 Chromosome and associated proteins [BR:plum03036]
    A4R40_16655 (rnc)
Enzymes [BR:plum01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     A4R40_16655 (rnc)
Messenger RNA biogenesis [BR:plum03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     A4R40_16655 (rnc)
Ribosome biogenesis [BR:plum03009]
 Eukaryotic type
  90S particles
   RNase
    A4R40_16655 (rnc)
 Prokaryotic type
  rRNA processing factors
   A4R40_16655 (rnc)
Chromosome and associated proteins [BR:plum03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     A4R40_16655 (rnc)
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm DSRM_2 DND1_DSRM RM44_endonuclase
Other DBs
NCBI-ProteinID: AWK43019
UniProt: A0A6L9JQX3
LinkDB
Position
complement(3967425..3968105)
AA seq 226 aa
MNPIVINRLQRKLGYTFDQYDLLIQALTHRSASSKHNERLEFLGDSILSFVIANALYHRF
PRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGYRRESILADTVEALI
GAIFLDSDIQSIERIILSWYETRLNEISPGDKQKDPKTRLQEYLQGHHLPLPSYLVVMVR
GEAHDQEFTIHCQVSGIEQPVKGTGSSRRKAEQAAAEQALKQLELE
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaatcccatcgtaattaacagattgcagcgtaagctggggtacacttttgatcagtat
gatttgctgatacaagcgttaactcatcgtagtgccagcagtaaacataatgagcggctg
gaatttcttggtgactcaatcctgagttttgttattgccaatgcgttgtatcatcgtttt
cctcgtgtagatgagggggatatgagccgcatgcgtgccacattggtgcgtggtaatacc
ctggctgaattggcaagggaatttgaactaggtgaatgccttcgtttggggccaggagaa
ttgaaaagcgggggttaccgtcgtgaatcaatactggctgataccgttgaagcgctgatt
ggtgctatcttccttgatagcgatattcagtctattgaaagaattattctgagctggtac
gaaacccgcctgaatgaaatcagccctggcgacaaacagaaagatccgaaaacccgttta
caggaatatttgcaagggcatcatctgcctctgccatcatatctggttgttatggttcgt
ggtgaagctcacgatcaagaatttactattcactgtcaagtgagcggtattgaacagccg
gttaaaggaacaggctccagccgtcgcaaagcggaacaggcagcggctgagcaagcatta
aaacaactggagcttgaatga

DBGET integrated database retrieval system