Paenibacillus lutimineralis: EI981_06685 Help Entry EI981_06685       CDS       T06479                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plut  Paenibacillus lutimineralis Pathway plut00998   Biosynthesis of various antibiotics plut01100   Metabolic pathways plut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EI981_06685    00074 Mycolic acid biosynthesis     EI981_06685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EI981_06685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AZS14173 UniProt:  A0A3Q9I728 LinkDB All DBs Position 1644701..1644970 Genome browser AA seq 89 aa AA seqDB search MEETISFLQFQSIFAEYLGIDSSRLTREVNLLLELGVDSLSLVNAMIRLEREYQVMFKPE DAIMTRTLGEAYDLFVNYRSQGEEIQSGI NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggaagaaacaataagctttctgcagtttcagagcatttttgcggagtatctggggatt gattcttcccggcttacccgggaggttaatctgttgcttgagctgggggtggattcgttg tccctggtcaatgcgatgattaggttggagcgggaatatcaggtcatgttcaaaccggag gatgccatcatgactcgcaccctgggtgaagcctatgatttattcgtcaattaccgcagc cagggggaagaaattcagagcggtatttaa

DBGET integrated database retrieval system