Paenibacillus lutimineralis: EI981_06715 Help Entry EI981_06715       CDS       T06479                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plut  Paenibacillus lutimineralis Pathway plut00998   Biosynthesis of various antibiotics plut01100   Metabolic pathways plut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EI981_06715    00074 Mycolic acid biosynthesis     EI981_06715   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EI981_06715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AZS14179 UniProt:  A0A3S9UUZ9 LinkDB All DBs Position 1651614..1651880 Genome browser AA seq 88 aa AA seqDB search MQDELYGIIADICYFEKDEMHPALSVVDDLAISSVMIVEIIAMIEARYGFNIEEQIDELL GCELLGDMTTLITRLGEDYAVAQAALGR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcaggatgagctttatggaatcattgcggacatatgttactttgagaaggatgaaatg catccggctttatcggttgtcgacgatctggcaatcagctccgttatgattgttgagatc atcgccatgattgaggcccggtacggcttcaacatagaggagcaaatcgatgaattactc ggctgcgagttgctcggcgacatgacgacgctgatcacccggctgggagaagactatgca gtagcccaagccgcgctagggaggtga

DBGET integrated database retrieval system