Paenibacillus lutimineralis: EI981_10300 Help Entry EI981_10300       CDS       T06479                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism plut  Paenibacillus lutimineralis Brite KEGG Orthology (KO) [BR:plut00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:plut03032]     EI981_10300    03036 Chromosome and associated proteins [BR:plut03036]     EI981_10300    03400 DNA repair and recombination proteins [BR:plut03400]     EI981_10300 DNA replication proteins [BR:plut03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EI981_10300 Chromosome and associated proteins [BR:plut03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EI981_10300 DNA repair and recombination proteins [BR:plut03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EI981_10300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 DUF2267 HU-CCDC81_euk_1 HU-DNA_bdg Rpf1_C Peptidase_C80 PaaA_PaaC Motif Other DBs NCBI-ProteinID:  AZS14811 UniProt:  A0A3Q9I8C4 LinkDB All DBs Position 2450105..2450377 Genome browser AA seq 90 aa AA seqDB search MNKSDLVSKVAESTELSKKDATKAVDAVFEAISEALQSGDKVQLVGFGNFEVRERSARKG RNPQTGEEIEIPASKIPAFKPGKALKDGIK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatctgatttggtatccaaggtagctgagagcacagaattgtccaagaaggac gcaaccaaagcggttgatgctgtattcgaagccatttctgaagcacttcaaagcggagac aaagttcaactggttggctttggtaactttgaagttcgtgagcgttccgcacgtaaagga cgcaatccgcaaaccggagaggaaatcgaaatccctgcgagcaagatccccgctttcaaa ccgggtaaagcgctcaaagacggaattaaataa

DBGET integrated database retrieval system