Paenibacillus lautus: D5F53_11755 Help Entry D5F53_11755       CDS       T05701                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism plw  Paenibacillus lautus Pathway plw00362   Benzoate degradation plw00621   Dioxin degradation plw00622   Xylene degradation plw01100   Metabolic pathways plw01120   Microbial metabolism in diverse environments plw01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:plw00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     D5F53_11755    00622 Xylene degradation     D5F53_11755    00621 Dioxin degradation     D5F53_11755 Enzymes [BR:plw01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      D5F53_11755 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 DUF7366 STING_LBD Motif Other DBs NCBI-ProteinID:  AYB43928 UniProt:  A0A2A5LME6 LinkDB All DBs Position 2492760..2492942 Genome browser AA seq 60 aa AA seqDB search MPQITIKMYEGRTDEQKNEIVDVFTKELSRIIDREPEFISIRFDEIPIDDNAPAHLRNKR NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgccgcaaattacgattaaaatgtacgaaggacgcacggatgagcagaagaacgaaatc gttgacgtttttacaaaggagctgtcgcggatcattgaccgggagcctgaatttatcagc atccggtttgacgaaattccgatagatgacaacgcaccggcccatttgagaaacaagagg tga

DBGET integrated database retrieval system