Paenibacillus lautus: D5F53_17880 Help Entry D5F53_17880       CDS       T05701                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism plw  Paenibacillus lautus Pathway plw02024   Quorum sensing plw03018   RNA degradation Brite KEGG Orthology (KO) [BR:plw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     D5F53_17880  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     D5F53_17880  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:plw03019]     D5F53_17880    03036 Chromosome and associated proteins [BR:plw03036]     D5F53_17880 Messenger RNA biogenesis [BR:plw03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      D5F53_17880 Chromosome and associated proteins [BR:plw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     D5F53_17880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 DUF150_C Motif Other DBs NCBI-ProteinID:  AYB45032 UniProt:  A0A2A5LR75 LinkDB All DBs Position complement(3914828..3915067) Genome browser AA seq 79 aa AA seqDB search MNKSINIQDTFLNQLRKENIPATVYLTNGFQIRGTIKAFDNFTIVIDSDGRQQMVYKHAI STFMPQRNVSLMQDNNSEQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtccataaacatccaagacacgttcttgaaccaactgcgcaaagagaacatt ccggccacggtataccttacaaacggctttcagatccgtggaacgatcaaagcttttgac aattttaccatcgtgattgacagcgacggccgtcagcaaatggtgtacaagcatgctatc tccacgttcatgccgcagcgtaatgtgtccctgatgcaggataacaacagcgaacaatag

DBGET integrated database retrieval system