Planococcus sp. MB-3u-03: CW734_11165
Help
Entry
CW734_11165 CDS
T05387
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
KO
K03177
tRNA pseudouridine55 synthase [EC:
5.4.99.25
]
Organism
plx
Planococcus sp. MB-3u-03
Brite
KEGG Orthology (KO) [BR:
plx00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
plx03016
]
CW734_11165
Enzymes [BR:
plx01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.99 Transferring other groups
5.4.99.25 tRNA pseudouridine55 synthase
CW734_11165
Transfer RNA biogenesis [BR:
plx03016
]
Eukaryotic type
tRNA modification factors
Psudouridine synthases
CW734_11165
Prokaryotic type
CW734_11165
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TruB_N
TruB_C_2
Motif
Other DBs
NCBI-ProteinID:
AUD14084
LinkDB
All DBs
Position
complement(1964886..1965815)
Genome browser
AA seq
309 aa
AA seq
DB search
MEPNGILPLWKEPGMTSHDCVFRLRKILKTKKVGHTGTLDPQVDGVLPICLGRSTKVAEY
ITDQGKTYEAEVLIGFSTETEDAEGAVVEQDTGDKTITRKQLEGVLQSLTGDIEQIPPMY
SAVKVNGRKLYEYARKGEAVERPVRIVHIDSIELLDDADIWQGQNIRFRIRIRCGKGTYI
RTLAVQIGEALGYPAHMSQLTRTQSGSFTKQQCVTLAEVEEIAQNGDIGSILQPLAYGLS
AFPFEEITPDLLFGIKNGQVLEAHPVLKAEPFVVFTYQGVPAALYKRHPDKPGKMKPEKM
FGFPPTDEV
NT seq
930 nt
NT seq
+upstream
nt +downstream
nt
atggaaccgaatgggattcttccattatggaaagaaccgggcatgacgtcccacgattgc
gtttttcgcttgcggaaaatcctgaaaacgaaaaaagtcgggcataccgggacgctcgat
ccccaagtggacggcgtattgcccatttgcctcgggcgatcgaccaaagtggcagagtat
atcactgatcaaggaaaaacgtacgaagcggaagtattgatcgggttttcaacggaaaca
gaagatgcagaaggcgcagtagtggagcaagacacgggggacaagacgattacccgaaag
cagctagaaggcgtattgcaaagcctgaccggcgacattgaacaaatcccgccgatgtat
tccgccgtcaaagtgaacggcagaaagctttacgaatacgcgcgcaaaggcgaagcggtg
gaacgcccggtgcggatcgtgcatattgactcgattgaacttttggatgacgcggacatt
tggcaagggcagaatatccgtttccgcatccgcatccgctgtggcaaaggaacctatatc
cggacgcttgctgtccagatcggtgaagcgcttggctatccggctcatatgtcacagctg
acacgcacgcaatccggcagttttacgaaacaacaatgtgtgacgcttgccgaagtggag
gaaattgcgcaaaatggggatatcggttctattttgcagcctcttgcctatggcttaagt
gcatttccttttgaagaaatcacgccggatttattgttcggcatcaagaatggccaagta
cttgaggcgcatccggtcttgaaggcggaaccgtttgtcgttttcacgtatcaaggcgta
ccggcagcgttgtataaacggcatccggataagccgggcaaaatgaaacccgaaaaaatg
tttggatttcctccaacggacgaggtgtag
DBGET
integrated database retrieval system