Planococcus sp. MB-3u-03: CW734_14495 Help Entry CW734_14495       CDS       T05387                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism plx  Planococcus sp. MB-3u-03 Pathway plx00362   Benzoate degradation plx00621   Dioxin degradation plx00622   Xylene degradation plx01100   Metabolic pathways plx01120   Microbial metabolism in diverse environments plx01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:plx00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CW734_14495    00622 Xylene degradation     CW734_14495    00621 Dioxin degradation     CW734_14495 Enzymes [BR:plx01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CW734_14495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 CHMI Polyketide_cyc2 Motif Other DBs NCBI-ProteinID:  AUD14647 LinkDB All DBs Position 2644709..2644894 Genome browser AA seq 61 aa AA seqDB search MPYVTVKMLEGRTDEQKRALVEKVTAAVSETIDAPPEKVFVFLEDLKKSEYAVNGKLLND E NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgccatacgtaactgtaaaaatgctcgaaggccgcacagacgagcaaaaacgcgcacta gtcgaaaaggtcacagccgctgtatccgaaacaatcgatgccccaccagaaaaggttttt gtgttcctcgaagacttgaaaaaaagcgaatacgcggtcaacggcaagctgttgaacgac gagtag

DBGET integrated database retrieval system