Paenibacillus lycopersici: GXP70_12155 Help Entry GXP70_12155       CDS       T07013                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plyc  Paenibacillus lycopersici Pathway plyc01100   Metabolic pathways plyc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plyc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GXP70_12155 (acpP)    00074 Mycolic acid biosynthesis     GXP70_12155 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GXP70_12155 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  QHT60617 UniProt:  A0A6C0FUX4 LinkDB All DBs Position 2755971..2756207 Genome browser AA seq 78 aa AA seqDB search MSDVYDRVKRIVVDRLGVDESEVTLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDA EKITSVGEVVNYITSLAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccgatgtatatgatcgtgtaaagcgcatcgtagtcgaccgccttggcgtagacgag tcggaagtgacgctagaagcttcgtttaaagaagatcttggagcggactctcttgatgtc gttgaattggtcatggaactggaagatgagttcgatatggaaatctctgatgaagatgca gagaaaattacgagtgtaggagaagtcgtaaattacataacttctctggcgaagtaa

DBGET integrated database retrieval system