Paenibacillus lycopersici: GXP70_18630
Help
Entry
GXP70_18630 CDS
T07013
Name
(GenBank) ABC transporter ATP-binding protein
KO
K18890
ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
plyc
Paenibacillus lycopersici
Pathway
plyc02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
plyc00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
GXP70_18630
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
plyc02000
]
GXP70_18630
Transporters [BR:
plyc02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
GXP70_18630
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_22
AAA_29
DUF6019
AAA_16
RsgA_GTPase
MMR_HSR1
AAA
DUF87
AAA_25
DEAD
AAA_7
AAA_23
Dynamin_N
AAA_15
Zeta_toxin
Motif
Other DBs
NCBI-ProteinID:
QHT63994
UniProt:
A0A6C0G8B7
LinkDB
All DBs
Position
complement(4221193..4222908)
Genome browser
AA seq
571 aa
AA seq
DB search
MKPYRKKLVPVILIPMLLGTLTRLAIPALFIKAIDDAINPKAGDPSLSKLYMYGAMMLAL
YIIQWAANTYRIKYTNIIGQQVIYDLRHDLFRHIQKLSFRFFDKRPAGSVLVRVTNDVNA
LQDLFTNGVVNLMMDMVQLVGIVIILLFWNFQLGIAIMVTVPLMFVVSTALRRRIRFAWQ
DVRMKQSRINAHLNESIQGMRVTQSYTQEKANFSFFQGINQTNIKAWNKASALNQAFGPI
IEITSAIGTLILFWFGSHLIMTGAITVGVLVGFANYVGNFWDPINRLGQMYAQLLIAMAS
SERIFEFIDEEPTVGELTEARDLPRIFGDVHFENIVFEYEKGRPALKGIDLHVKAGETIA
LVGHTGSGKSTIMNLLCRFYDPVEGAVKVDGIDIRNVSLESLRSQVGVVLQDTFIFSGTI
RDNIRFGRLDATDDEIVKAATAVDAHDFIMNLPDGYDTQVQERGNILSMGQRQLLSFARA
LLADPRVLILDEATASIDTETELKIQEALKTLLKGRTSFIVAHRLSTIRNADRIVVLDHG
QIVEQGNHEELIRHKGTYNGLIEAQYRFLSA
NT seq
1716 nt
NT seq
+upstream
nt +downstream
nt
atgaagccttaccgcaagaagctggtgccggtcatcctgatcccgatgctgctcggcacg
ctgacgcggctcgcgattcccgccttgttcatcaaggcgatcgacgatgcgatcaatccg
aaggccggcgatccgagcctctcgaagctttacatgtacggcgcaatgatgctggccctg
tatattattcaatgggcggccaacacgtaccggattaaatacacgaatatcatcggccag
caggtcatctacgatcttcgtcacgatttgttccgtcatatccagaagctgtcgttccgg
ttcttcgacaagcggcctgccggatccgttctcgtacgggtgacgaacgacgtcaacgcc
ctgcaggatctgttcacgaacggcgttgtcaacttgatgatggatatggtgcagctggtc
gggatcgtcattattttgctcttctggaacttccagctcggcattgcgatcatggttacc
gttccgctcatgttcgtcgtgtccacggcgctgcgcagacggatccgcttcgcctggcag
gacgtgcggatgaagcagtcccgcatcaacgcgcatttgaacgaaagcatccaggggatg
cgcgtaacccagtcgtatacgcaggagaaagcgaacttcagcttcttccagggcattaac
cagacgaacatcaaagcgtggaacaaggcatcggcgctgaaccaggcgttcggaccgatc
atcgagatcacctccgccatcggcacgctcatcctgttctggttcggctcccatctgatc
atgaccggcgcgatcacggtcggcgtgctcgtcggcttcgccaactatgtcggcaacttc
tgggatccgatcaaccggctggggcaaatgtacgcgcagctgctgatcgcaatggcttcc
tccgagcggatcttcgaattcatcgacgaggagccgacggtcggcgaactgacggaagcc
cgcgatctgccgcggattttcggcgacgtccacttcgagaacatcgtcttcgaatacgag
aagggacgtccggcgcttaaaggcatcgacctgcacgtcaaagcgggcgagacgattgcg
ctcgtcggccataccggctccggcaagagtacgatcatgaacctgctctgccggttctac
gatccggtagaaggcgcggtgaaggtagacggcatcgatattcggaacgtcagtctggaa
agtctccgttcgcaggtcggcgtcgtgctgcaggatacgtttattttctcgggcacgatt
cgcgataacattcgtttcgggcgtctggacgcgaccgacgacgaaatcgtcaaggctgcg
acagcggttgacgcgcatgatttcatcatgaatttaccggacgggtacgatacgcaggtt
caggagcgcggcaacattttgtcgatgggtcagcgccagctgctgtccttcgcgcgcgcg
ctgctggccgatcctcgcgtcctgatcctcgacgaggcgacggcgagcatcgataccgag
accgagctgaagatccaggaagcgctcaagacactgcttaaaggccggacgtcgttcatc
gtcgcgcaccggctgtcgaccatccgcaacgcggaccggatcgtcgtgctggatcacggt
caaatcgtcgagcagggcaaccacgaagagctcatccgccacaagggcacgtacaacgga
ttgatcgaagcgcagtaccgctttttgtcggcctaa
DBGET
integrated database retrieval system