KEGG   Paenibacillus lycopersici: GXP70_18630
Entry
GXP70_18630       CDS       T07013                                 
Name
(GenBank) ABC transporter ATP-binding protein
  KO
K18890  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
plyc  Paenibacillus lycopersici
Pathway
plyc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:plyc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GXP70_18630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plyc02000]
    GXP70_18630
Transporters [BR:plyc02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    GXP70_18630
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA_29 DUF6019 AAA_16 RsgA_GTPase MMR_HSR1 AAA DUF87 AAA_25 DEAD AAA_7 AAA_23 Dynamin_N AAA_15 Zeta_toxin
Other DBs
NCBI-ProteinID: QHT63994
UniProt: A0A6C0G8B7
LinkDB
Position
complement(4221193..4222908)
AA seq 571 aa
MKPYRKKLVPVILIPMLLGTLTRLAIPALFIKAIDDAINPKAGDPSLSKLYMYGAMMLAL
YIIQWAANTYRIKYTNIIGQQVIYDLRHDLFRHIQKLSFRFFDKRPAGSVLVRVTNDVNA
LQDLFTNGVVNLMMDMVQLVGIVIILLFWNFQLGIAIMVTVPLMFVVSTALRRRIRFAWQ
DVRMKQSRINAHLNESIQGMRVTQSYTQEKANFSFFQGINQTNIKAWNKASALNQAFGPI
IEITSAIGTLILFWFGSHLIMTGAITVGVLVGFANYVGNFWDPINRLGQMYAQLLIAMAS
SERIFEFIDEEPTVGELTEARDLPRIFGDVHFENIVFEYEKGRPALKGIDLHVKAGETIA
LVGHTGSGKSTIMNLLCRFYDPVEGAVKVDGIDIRNVSLESLRSQVGVVLQDTFIFSGTI
RDNIRFGRLDATDDEIVKAATAVDAHDFIMNLPDGYDTQVQERGNILSMGQRQLLSFARA
LLADPRVLILDEATASIDTETELKIQEALKTLLKGRTSFIVAHRLSTIRNADRIVVLDHG
QIVEQGNHEELIRHKGTYNGLIEAQYRFLSA
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgaagccttaccgcaagaagctggtgccggtcatcctgatcccgatgctgctcggcacg
ctgacgcggctcgcgattcccgccttgttcatcaaggcgatcgacgatgcgatcaatccg
aaggccggcgatccgagcctctcgaagctttacatgtacggcgcaatgatgctggccctg
tatattattcaatgggcggccaacacgtaccggattaaatacacgaatatcatcggccag
caggtcatctacgatcttcgtcacgatttgttccgtcatatccagaagctgtcgttccgg
ttcttcgacaagcggcctgccggatccgttctcgtacgggtgacgaacgacgtcaacgcc
ctgcaggatctgttcacgaacggcgttgtcaacttgatgatggatatggtgcagctggtc
gggatcgtcattattttgctcttctggaacttccagctcggcattgcgatcatggttacc
gttccgctcatgttcgtcgtgtccacggcgctgcgcagacggatccgcttcgcctggcag
gacgtgcggatgaagcagtcccgcatcaacgcgcatttgaacgaaagcatccaggggatg
cgcgtaacccagtcgtatacgcaggagaaagcgaacttcagcttcttccagggcattaac
cagacgaacatcaaagcgtggaacaaggcatcggcgctgaaccaggcgttcggaccgatc
atcgagatcacctccgccatcggcacgctcatcctgttctggttcggctcccatctgatc
atgaccggcgcgatcacggtcggcgtgctcgtcggcttcgccaactatgtcggcaacttc
tgggatccgatcaaccggctggggcaaatgtacgcgcagctgctgatcgcaatggcttcc
tccgagcggatcttcgaattcatcgacgaggagccgacggtcggcgaactgacggaagcc
cgcgatctgccgcggattttcggcgacgtccacttcgagaacatcgtcttcgaatacgag
aagggacgtccggcgcttaaaggcatcgacctgcacgtcaaagcgggcgagacgattgcg
ctcgtcggccataccggctccggcaagagtacgatcatgaacctgctctgccggttctac
gatccggtagaaggcgcggtgaaggtagacggcatcgatattcggaacgtcagtctggaa
agtctccgttcgcaggtcggcgtcgtgctgcaggatacgtttattttctcgggcacgatt
cgcgataacattcgtttcgggcgtctggacgcgaccgacgacgaaatcgtcaaggctgcg
acagcggttgacgcgcatgatttcatcatgaatttaccggacgggtacgatacgcaggtt
caggagcgcggcaacattttgtcgatgggtcagcgccagctgctgtccttcgcgcgcgcg
ctgctggccgatcctcgcgtcctgatcctcgacgaggcgacggcgagcatcgataccgag
accgagctgaagatccaggaagcgctcaagacactgcttaaaggccggacgtcgttcatc
gtcgcgcaccggctgtcgaccatccgcaacgcggaccggatcgtcgtgctggatcacggt
caaatcgtcgagcagggcaaccacgaagagctcatccgccacaagggcacgtacaacgga
ttgatcgaagcgcagtaccgctttttgtcggcctaa

DBGET integrated database retrieval system