Paenibacillus sp. lzh-N1: C0638_07515 Help Entry C0638_07515       CDS       T10344                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism plzh  Paenibacillus sp. lzh-N1 Brite KEGG Orthology (KO) [BR:plzh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:plzh03032]     C0638_07515    03036 Chromosome and associated proteins [BR:plzh03036]     C0638_07515    03400 DNA repair and recombination proteins [BR:plzh03400]     C0638_07515 DNA replication proteins [BR:plzh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C0638_07515 Chromosome and associated proteins [BR:plzh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C0638_07515 DNA repair and recombination proteins [BR:plzh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C0638_07515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AUO06384 LinkDB All DBs Position complement(1665261..1665533) Genome browser AA seq 90 aa AA seqDB search MNKTDLINNISSKSGLSKRDVEAVLNGVLGEITDALASGDKVQLIGFGTFETRKRSSRTG RNPQTGNTIEIPESTVPAFKAGNKLKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacagatctgatcaacaatatttccagcaaaagcggtttgagcaaacgtgac gttgaagctgtattgaatggcgttcttggtgaaattacagatgcacttgctagtggtgac aaagtacaactaatcggctttggtactttcgaaacgcgcaaacgttccagccgtacaggt cgcaatccacaaaccggcaacacgattgaaattccagaatcgaccgttcctgcttttaag gctggtaataagcttaaagaagccgttaactaa

DBGET integrated database retrieval system