Paenibacillus sp. lzh-N1: C0638_18400 Help Entry C0638_18400       CDS       T10344                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism plzh  Paenibacillus sp. lzh-N1 Brite KEGG Orthology (KO) [BR:plzh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:plzh03032]     C0638_18400    03036 Chromosome and associated proteins [BR:plzh03036]     C0638_18400    03400 DNA repair and recombination proteins [BR:plzh03400]     C0638_18400 DNA replication proteins [BR:plzh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C0638_18400 Chromosome and associated proteins [BR:plzh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C0638_18400 DNA repair and recombination proteins [BR:plzh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C0638_18400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-DNA_bdg DUF2267 SIS_2 DUF937 Motif Other DBs NCBI-ProteinID:  AUO09672 LinkDB All DBs Position 4070182..4070454 Genome browser AA seq 90 aa AA seqDB search MNKTDLINQVSESTELSKKDVTKAIDAVFEAIAGALQNGDKVQLVGFGNFEVRERSARKG RNPQTGEEIEIPASKIPAFKPGKALKDGIK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaataaaacggatttgatcaatcaggtttctgagagcactgaattgtccaaaaaggac gtaaccaaagcaatcgatgcagtatttgaggcgatcgctggtgcactgcaaaacggagac aaggtacaactggtaggtttcgggaactttgaggttcgtgaacgttccgcacgtaaagga cgtaacccgcaaacaggagaagaaatcgaaatccctgcgagcaaaattccggcattcaaa ccgggtaaagcgctcaaagacggaattaaataa

DBGET integrated database retrieval system