Pseudomonas marginalis: U0037_06450 Help Entry U0037_06450       CDS       T10241                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pmab  Pseudomonas marginalis Brite KEGG Orthology (KO) [BR:pmab00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmab03036]     U0037_06450 (ftsB) Chromosome and associated proteins [BR:pmab03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     U0037_06450 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ACCA_BT Motif Other DBs NCBI-ProteinID:  WQD73600 LinkDB All DBs Position 1431543..1431821 Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLVLLLLLAGLQYRLWVGNGSFAQVKDLTEQIAAQHAENEILLERNRVLDAEV LELKKGTETVEERARHELGMVKEGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcccaattggttgttcctcgtcttgctcttgttgctggctggcctgcaatac cgcctatgggtgggtaatggcagctttgcgcaggtgaaagacctgaccgagcaaattgct gcacagcacgccgaaaacgagatcttgctggagcgcaaccgcgtcctcgatgccgaagtg cttgagctgaaaaaaggcacggagaccgttgaagagcgggctcgtcatgaactgggcatg gtcaaggagggcgaaaccctctaccagttggcccaatga

DBGET integrated database retrieval system