KEGG   Papilio machaon (common yellow swallowtail): 106718535
Entry
106718535         CDS       T05138                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106718535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pmac00199]
    106718535
Enzymes [BR:pmac01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     106718535
Cytochrome P450 [BR:pmac00199]
 Cytochrome P450, animal type
  CYP306 family
   106718535
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 106718535
NCBI-ProteinID: XP_014368135
LinkDB
Position
Unknown
AA seq 539 aa
MDFIFLWLVTFVLGFWICKKMKEWRSLPPGPWGLPIVGFLPFIDRNQPHLTLTKVAKQFG
PIYGISMGNVYTVVLSDHRLVREAFAKEAFSGRAPLYLTHGIMQGNGIICAEGGLWKDQR
KLVTMWLKSFGMSKYSVSREKLERRIAVGVNELLQNVKQASGAPIDLPSMLTNSLGNVVN
EIIFGYKYPSDDKTWKWFRQIQEEGSHEMGVAGVVNFLPFIRFISQSIRNTMRILIRGQA
QTHALYAAIIEMRRKVLKIEAPEGAKYPLHENLFKQHPKGFIKCIKYSKHASETEEHYFD
PEILIPTDGECILDNFLLEQKKRFDNDAETAKYMTDEQMFYLLADMFGAGLDTTSTTLAW
FLLYMALHPEEQETVRREILSVLIDDNDSDYTKLPRLMAAICETQRIRSIVPVGIPHGCT
EDTYLGEYRIPKGAMVMPLQWAMHMDPDVWEDPEEFKPSRFLDEDGNLLKPQQFIPFQTG
KRMCPGDELSRMMSCGLITRLFRHMRVRLADETPTEEEMQGTVGVTMTPPKKLYVCVPL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggattttatattcttatggctagttactttcgtacttggattttggatctgtaagaag
atgaaggaatggcgcagcttacctcctggtccttggggattacccattgtgggattcttg
ccattcattgatcggaatcagcctcatctgactttaacgaaggtcgccaaacaatttggc
ccaatatatggaatatcaatgggcaacgtgtacacagtagtgttgtccgatcatagatta
gttagagaagccttcgcaaaggaagcattctccggacgagctccactttatttgacgcat
ggtatcatgcaaggaaatggtataatttgtgctgagggtggattatggaaggatcaacgt
aaactggtgacgatgtggttgaaaagcttcggtatgagcaagtacagtgtgtcccgcgag
aagttggagcgacgaatcgccgtcggcgttaacgaactactacaaaatgtcaaacaagct
tctggagccccaattgatctaccatcgatgctaacaaattcactggggaacgttgtaaat
gagattatatttggttacaaatacccgtctgacgataaaacatggaaatggttcagacaa
atacaagaagaaggcagtcatgaaatgggtgttgccggagtggttaactttttacctttt
attcgatttatttcacaatccattcgaaatacgatgagaattctaatacgtggtcaagcc
caaactcacgctctttatgcagctattattgaaatgcgacgcaaagttctaaaaattgaa
gctcccgaaggtgccaaatatcccttacatgaaaatctgttcaaacagcatcccaaaggc
tttataaaatgtataaagtacagcaaacacgcgtcagaaacggaggagcattacttcgat
cccgaaattcttataccgacagatggtgaatgtattctagacaatttcctcttggaacaa
aagaaacggttcgacaacgacgctgagactgcaaagtacatgacagatgaacagatgttt
tatctactcgcagacatgttcggggcaggccttgatactacgtcgactactctcgcctgg
tttttgttgtatatggctctgcacccggaagaacaggaaactgtgcgtcgtgagatctta
tctgttttaattgatgataatgatagcgattatacaaagttacctcgtctaatggcggcc
atttgtgagacgcagcgcattcgatctatagtgcccgttggcattcctcatggatgcact
gaagatacatatttgggcgaatacagaattccaaaaggcgctatggtaatgccgctgcag
tgggcaatgcacatggaccctgacgtatgggaggatcccgaggaatttaaacccagtcgg
ttcttagatgaagacggaaatttattgaagccgcaacaattcataccttttcaaacagga
aagcgaatgtgtccgggagatgaactttctcgtatgatgtcgtgtggtttgataacccgt
ttgttccgccatatgcgcgtacgattagccgatgaaactccaactgaagaggaaatgcaa
ggcacggtcggggtcacaatgacgccgccaaaaaaactgtatgtctgtgtaccgctttaa

DBGET integrated database retrieval system