Prauserella marina: BAY61_07800 Help Entry BAY61_07800       CDS       T04988                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism pmad  Prauserella marina Pathway pmad00253   Tetracycline biosynthesis pmad01056   Biosynthesis of type II polyketide backbone pmad01100   Metabolic pathways pmad01110   Biosynthesis of secondary metabolites Module pmad_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:pmad00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     BAY61_07800    00253 Tetracycline biosynthesis     BAY61_07800  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:pmad01004]     BAY61_07800    01008 Polyketide biosynthesis proteins [BR:pmad01008]     BAY61_07800 Lipid biosynthesis proteins [BR:pmad01004]  Polyketide synthase   Component type    BAY61_07800 Polyketide biosynthesis proteins [BR:pmad01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      BAY61_07800     Nonaketide PKS      BAY61_07800     Decaketide PKS      BAY61_07800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASR34898 UniProt:  A0A222VLV2 LinkDB All DBs Position complement(1710664..1710915) Genome browser AA seq 83 aa AA seqDB search MSELTLSELVTIMRKCAGEEESVDDGGDIGNVLLESLGYDSLALMEAAATVKRAYRVQLP DDALAEVRTLNQFVTAVNQAGRA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgagctcacgttgtccgagttggtcacgatcatgcgtaaatgcgccggagaggag gagtcggtcgacgacggcggagacatcggcaacgtgctccttgagagcctcgggtacgac tcactggcgctgatggaggccgccgcgacggtcaagcgcgcgtaccgggttcaactgccc gacgacgcgctcgccgaggtgcgcacgctcaaccagttcgtgaccgccgtcaaccaagcc ggacgcgcgtga

DBGET integrated database retrieval system