Paenibacillus macerans: LMZ02_02360 Help Entry LMZ02_02360       CDS       T09394                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pmae  Paenibacillus macerans Pathway pmae00190   Oxidative phosphorylation pmae01100   Metabolic pathways Module pmae_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pmae00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     LMZ02_02360 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pmae00194]     LMZ02_02360 (atpE) Photosynthesis proteins [BR:pmae00194]  Photosystem and electron transport system   F-type ATPase [OT]    LMZ02_02360 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  UMV48272 LinkDB All DBs Position complement(524231..524458) Genome browser AA seq 75 aa AA seqDB search MGAMALLAAAIVAGLGAFGAALGNGMVISKTVEGIARQPEAKSTLQTTMFIGVGLIEVLP IIGVVLAFMFYGLAG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgggagcaatggcattattggcagcagctatcgtagcaggtttgggcgcgtttggcgca gcgctgggtaacgggatggttatcagcaaaacggtcgaagggatcgcgcgtcaaccggaa gcgaaatccactctgcaaacgacgatgtttatcggcgttggtctgatcgaggtccttccg atcatcggcgtggtcttggccttcatgttctatggtttggccggctaa

DBGET integrated database retrieval system