Providencia manganoxydans: JI723_12860 Help Entry JI723_12860       CDS       T08377                                  Symbol flgM Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pmag  Providencia manganoxydans Pathway pmag02020   Two-component system pmag02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pmag00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     JI723_12860 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     JI723_12860 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pmag02035]     JI723_12860 (flgM) Bacterial motility proteins [BR:pmag02035]  Flagellar system   Flagellar assembly proteins    Others     JI723_12860 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QQO61180 LinkDB All DBs Position 2865165..2865479 Genome browser AA seq 104 aa AA seqDB search MAIEQTPAISALTQVTTRDPQDATTTLRDKKVSTTESVKESVFSPSELQKKLLQPQASDI NSEKVEKIKQAIKDGTLKMDAGKVADGILRDAHESMLSMKNEAR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggctatcgagcaaacacctgcaatttcagcattaactcaagtcaccactcgtgatcca caggatgcgacaacaactcttcgcgataaaaaagtttcaaccactgaatctgtgaaagaa agcgttttttcacccagtgaattgcaaaagaagctgttacaaccgcaagcaagcgatatt aatagtgaaaaagttgaaaaaattaaacaagctattaaagatggcacattgaaaatggac gcgggaaaagtggcagatgggattttacgtgatgcacatgaatccatgctttcaatgaaa aatgaagcaagataa

DBGET integrated database retrieval system