Paramixta manurensis: PMPD1_1760 Help Entry PMPD1_1760        CDS       T10259                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmak  Paramixta manurensis Pathway pmak01100   Metabolic pathways pmak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PMPD1_1760    00074 Mycolic acid biosynthesis     PMPD1_1760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PMPD1_1760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QKJ86710 UniProt:  A0A6M8UG56 LinkDB All DBs Position 1838377..1838646 Genome browser AA seq 89 aa AA seqDB search MDALILDIKQMIIDTLNLEEISVDEIDADAALFGDGLGLDSIDALELGLAVKNRYGVLLS AESETMRQHFFSVASLASFINAQRAARSA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggatgcgttaattctcgacataaaacagatgatcattgatacgctaaatcttgaagag attagtgttgatgagatcgatgccgatgcggcactgtttggcgacggtctgggccttgac tcgatcgatgcgttggaactgggattggcggtgaaaaatcgttatggcgtgctgctttcc gccgaaagcgaaaccatgcgccaacattttttctcggttgcctctctggcatcgttcatt aatgctcagcgcgctgcgcgaagtgcctga

DBGET integrated database retrieval system