Paramixta manurensis: PMPD1_2964
Help
Entry
PMPD1_2964 CDS
T10259
Name
(GenBank) hypothetical protein
Organism
pmak Paramixta manurensis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Big_13
Big_6
DUF4625
Big_3_2
BapA_N
Big_3_3
Glucodextran_B
Big_9
Motif
Other DBs
NCBI-ProteinID:
QKJ87898
UniProt:
A0A6M8UB02
LinkDB
All DBs
Position
complement(3104044..3114579)
Genome browser
AA seq
3511 aa
AA seq
DB search
MAQLNQGRVDIISRENGTFISQTNGGFSHTVALNEASVVRINGTQSLVTTYERQGNDLIL
HMRDGSVVRYQRFFFNDTDGLHSELVFDDGTHLPVHALFPAADGAADATALVAVTPTYES
LNSIDPLLLADNDSNTGVITAAGLGVLGLAGIGIAASGGGGGHHHNNDNNNNGGNGNNGN
GGDGNNGNGGNGNNGNGGNGNNGNGGNGNNGNGGNGNGGDGEGGNGNEGNGANGTPTLNL
PFGDGTLNSGEAGSDQTLSGNTGVSGPNQTVTVTLGDHQYTGTPANDGSWTITLPSGDLQ
DLPQGNNQIVVVVTDPAGNSSTSTTPIVVDTIAPTLTVNPIAADGMLNAQEQSQPLEISG
SGEANDTVTVTLNGHTYTTTVGDNGQWSVAVPATDLAELSDGSHPVAVSISDAAGNSTNQ
TAPLTVKADEANLPSITVNTFAGNNILDGAEQHTTQTLSGTTQHVEAGQTVTVTLDGQNY
TAVVQPSGDWSVQIPSSALLALENGTATIHVVVNDIAGNSADNALEFTVNNAASGLSVNP
LSDDGYLNASEANENLVVSGTSSNIPVGNEVTVTFNGQTYTAEVADNGNWSITIPAADLA
GLPDGAAPLTVTAIDTGGNPVDTSATLNVIVHTLPEVTLQTPFGDGALNAAESATEQTLQ
GETGVSGDGQSVTVSLGGSNWTGSVDGDGHWSVTLPADALQALAEGGTSIVVTVSDAAGN
QSSTTAPVVIDRTAPTLAVDPVAGDGIVNAVEAAQPITIGGSSDAPQGQTVTVTLNGETY
TTEVDAQGHWSVELPAGTLLDAEPGSYPLTVTVSDAAGNPISTTSDIQVATASLAPTIDT
PFGDGYLNIREAQDGQTLSGSTGSTSEGQTVTVNVGGTEYPAVVDAQGNWSVALDAETLQ
GYQDGALPITVTVTDAAGNMGSVNSTVSVDYSAPTLNVGNVAGDNIINRAEALQAQTISG
TASPADAGQTVQITFNGETLQAVVQNDGSWSVTLPASALQGLADGEYHLGVTLTDAAGNP
ASIDHLLTLAASPASQPTLSIDAVTGDDYINRSEAAQGISISGSATGLETGQTVTVTLNG
QNYTTTVTAQGDWRVDVPAQALGQLSDGRQTITVTASDVAGNPASATHDVTVVAGAASQP
VIEINTVAGDDVVNAQEAQQPLVISGTSQHLDDGASITVSLNGKTYSATVDAEGNWSATV
PAQDVQALTQGDNHVTATATDIAGNPADDSHDFSVDTQPPALLDIDLGVGSDGILNLAEA
VAGITIGGTTDAGLTVTLTLNDKTYTATADTQGHWSVALSSGDLLALADGTAQVGLSVTD
ASGNTASQLVDLNVAINTLPALTLDTPLFGDGLLNVAEADGALTLTGTATHLEPGTEVTV
TIGNLTFSGTVATGGRWEVSIPAGALSALPDGNVQVEVSAVDAAGNPAGIAGNVEIVLST
LPEAAIQVPFVDGALNAAEADSDQVIRGTTGISGEGQQVSVVITGLNNDQPLTATVDAGG
HWSLNLSPSQLADLANGSHTITATVTDRAGNSDSASLDFNSIINGLPDPTLNTPFTDGIL
NLTEAQAGGALSGVTGITGEQTVIVTVNGTGFEATVDEETGQWSLDLPASELQTLPDGNW
PIEVSVTDSVGNSATIDGALQVAIHTLPVVTINLPFGDGSLNIIEATLDQQITGRTGITS
AGQTVSVVISGLNNGDPFEASVDANGNWSLNLSPQQLASLSDGTHTIEVTATDAAGNSAT
QSLEVIAALTPADPVINPPFGDGILNIDEAAGAVILTGTTGLSGENQGVQITIDLGGITY
TGTVDAEGNWSVGIPAGALGNLNNGTHTIDLTIVDAAGNVTNDSLVFTAALTAPTPTLNV
PFGDSLINLQDVEDGATLTGTTGTTGDAQSVTVNVGGTDYTATLNGDGSWSLALSSEQLN
LLDQGDNTLSVRVVDSNGNATTIGGNFTVDTVAPTVNIDPFTGDNSLTYAESILAQTLSG
SAGVENAGSTVTVTLGASTLTGIVDDEGNWQVAVMPGVMAQLANGSDTITVTITDPAGNS
NSASTTLTVDLTPPDDPLLTLDPIGGDNILNASETGSVTVTGSFSHFLVGSTVNITVNGV
LVGTDVVVGSEGNWSVNLPAAIFGSDGNYTVSASAVVGLDTVSTGATVVVDRTAPELTIN
AFTADNVLNESESGVTQTLSGTASISEAGRTVTLTLNGKTYTAVVQANGNWSTNIAAADL
QALQDGPQTLHASLSDRAGNLSEVDHNFTVDTGAPLLQVDALLGNNVLNAADILLTQTLT
GTASGAEGQTIGLYLGDANPIATAVVNADGTFALQLTPEVLDSLTEGALVFGVRVSDAAG
NQTDATLTVNKIINQGLTLIVDSVFGDGTLSALDSTVAQTISGVAKLAGIGATVTLDIGD
TTLSAKVGQDGKWAIIVPPNILGLLADGDINLNLTLSDAAGNTRTVGETVTAIIHNLPVI
GDLSHLFGVDNLLNIGDLAQNQTIGGLLNAATGSTVIVTLGSKSYQTQVTAGGQWGLTIP
ALDLGHLLDGTLSLGVKVIDPAGNVASSAVDVGIFGTAPSISLSPIFGDGILNALDLVTG
QTISGVVNHVAAGAQVTISIGNSTVTAVVGQNGAFSATVSPDILGTLLNGNLTVGVSVTD
AAGNTTSTSAGLVVNVTIPGIELNPIFGDGLLNAADALLTQVISGHITNATPGSKVEVTL
AGQHLITTANANGDFSVALSPAILQGLLDGNLTVGIKVTDSAGNSAETSAGVKVGIHNLP
VITLDPLFGDGVLNLLESIATQTITGQVANAAAGSVVTVNIGNSTVTAAVDDTGHFSAQV
SPDILGTLLNGNLTVGVSVTDAVGNTASVSAGVQIGINTPPTLTVNTLFGDGVLSAVDLN
SAQTISGSSSHLSNGTLVTVTLGGKTYTAQVGSNGNWTLSVPKADLALLSDGTLAVEVRA
TDAFGNEATGSGALNVIAHTPPTVTIATIFGDGQLNATDVLSAQTIVGTSTNAEGSTIQV
AIGGQTFTGTVGADGSWSVSVPAASLATIADGTQTVTASVTNLAGGTGSDAGNLLVGTHT
LPSVTLGTLFGGDGFLNLAEAANGETISGNATNAQGSSVAVTIAGTTFTTTVGAEGSWSI
TIPAETLQALSDGSHSLSVTLTDAVGNISTANSSFNAVTHNLPIIGVDPVLSLVSVLLTG
LTISGGTLNLKQGTMLNVTLNGHTQQTTTDALGRYSIKFAGGLLTALSLSSIVTVTAVDA
AGNPAATSTTLLLGSLLPVAASAEVHSAALVAVDDSGTASAGDQSHSVAAPTASEQKSTA
ESAHTEAVPVASTLVTETDSAALSVSDTHALNAPVAHGASPTESTADEAYSIGGVTIVLA
DGSMQEGAFITGSQGEDTVTLNTLNFGHIDGGSGVDTLVLNGEHMTLDLTSLGLKIENVE
VLDLGKSGTNGIKLDLHDALTLTDTPQDDLLIKGADGGEVTLANTEGGVWSSTGQRTVEG
HTYDVYHNSALTADNTLGDVLIQHNLQVHVV
NT seq
10536 nt
NT seq
+upstream
nt +downstream
nt
atggcacagctcaaccaaggtcgcgtggatattatttcgcgcgaaaacggcacgtttatt
tctcaaactaacggtggtttttcccataccgtggccttaaacgaagccagcgtggtgcgt
attaatggcactcagtcgctggtaaccacctatgagcgccagggaaatgatctgatcctg
catatgcgtgatggcagcgtggttcgctaccagcgttttttcttcaatgataccgatgga
ttgcatagcgaactggtatttgatgatggtacccatctaccggtacatgcgttattcccg
gctgctgatggcgcggcggatgcgactgcgttggtggcggtgacgccaacctatgaatcg
cttaattctatcgacccgttactgctggccgataatgacagcaatactggcgtcataact
gcggcagggttaggcgtgcttggcctggcggggattggtattgcagcgtccggcggtggc
ggcggtcatcaccacaataacgacaacaataataacggtggtaatggcaataacggtaac
ggcggggatggtaataacggcaacggcgggaatggtaataacggcaacggcgggaatggt
aataacggcaatggcgggaatggtaataacggcaatggcgggaatggtaatggaggggat
ggagagggcggcaatggcaacgagggcaatggcgccaacggtacccccacactaaatctg
ccatttggcgatggcacgctaaatagcggtgaggcaggcagcgatcaaacgttaagcggt
aataccggtgttagcgggccaaaccaaacggtaacggtcacccttggcgatcaccaatat
accggcaccccggcgaacgacggtagctggacgataacgttgccatcaggcgacttacag
gatctaccacaaggcaataatcaaattgtggtggtggtcaccgaccctgccggtaatagc
agtacctccaccacgccgatagtggtcgacactatcgcgccaactttgacggttaacccg
attgccgcagacggaatgctgaatgcgcaagagcagagccaaccgctggagattagcgga
agcggcgaagcgaatgacacggtcaccgttacgctaaatggtcatacttacaccaccacg
gtaggcgacaatgggcagtggtcagtcgctgtgccggctactgatttagccgaacttagc
gatggctcacatccggttgctgtttcaatcagcgatgctgccggtaatagcaccaatcaa
accgcaccgttaaccgttaaagccgatgaagcgaacctaccctcgatcacggtgaacact
tttgccggaaacaatattttggacggcgccgaacaacacaccacgcaaacgctctctggt
accacacaacatgttgaggctggacaaacggttaccgtgacgctggatgggcaaaactac
acggcggtggtgcaacccagcggagactggagcgtacagattccgtcttcggcgctgctg
gcattagaaaatggcaccgcgactatccatgtagtcgtgaatgatattgccggaaatagc
gcggataacgcccttgagttcaccgttaacaatgctgcctccggtttatcggtcaacccc
ttaagcgatgatggttacctcaatgccagcgaagcgaatgaaaacctggtagtgagcggt
acctcatccaatattcccgttggtaatgaggtgacggtaaccttcaatggccagacctat
accgctgaagtggctgacaacggcaactggagcataaccatcccggcggcggatttagcc
gggttaccggatggcgccgctccgctgacggttaccgctatcgacacgggcggtaatccg
gtggataccagtgcgacgctgaacgttatcgttcataccttaccggaagtgacgttacaa
acgccgtttggcgatggcgcgttgaacgcggcggagtcggcgaccgaacagacgttacaa
ggagagaccggggttagcggcgatggtcaaagcgtgacggttagcttgggtggttctaac
tggaccggtagcgttgatggtgatggacactggtcggtcacgctgcctgctgatgcattg
caggcgttggcggaagggggtaccagtatcgtggtcaccgtcagcgatgcggcgggcaat
cagagcagtaccaccgcgccagtggtgattgatcgtaccgcgccgacgcttgcggtcgat
ccggtcgctggcgatgggattgtcaacgcagtcgaagccgcgcaacccatcaccatcggc
ggcagcagtgacgcaccgcaagggcaaactgttactgtaacgctgaatggagagacgtat
accaccgaggtcgatgcgcaaggtcattggtcggtggaattacccgcgggcacgttgcta
gacgctgaaccgggtagctatccactgactgtcaccgtcagcgatgcagccggtaatcca
atcagtaccaccagcgatattcaggtggcgaccgcctcgctagcgcccaccatcgatacg
ccatttggcgatggttacctcaatattcgcgaagcacaagacggacaaacgctatcgggt
tccaccggttcaaccagcgaggggcagaccgtcaccgttaatgtaggcggaaccgagtat
ccggcggtcgtcgatgcgcaaggtaactggtcagtcgcgttagacgcagagacattgcaa
ggttaccaggatggcgctttaccaataacggttaccgtgaccgacgccgccggtaatatg
ggcagcgtcaacagtaccgtcagcgttgactacagcgccccaaccttgaatgtcggtaat
gtagccggcgacaatattattaatcgggcggaagccttacaagcccaaaccatcagcggc
acggcatcgccagcagatgccggacaaaccgtacagattacgttcaatggcgaaactctg
caggcagtggtgcaaaacgatggtagctggagcgtcacattgccagccagtgcgttacaa
gggctggcggatggcgaatatcatctcggcgtaaccttaaccgatgcggcgggtaaccct
gccagcattgatcatctcctcacgctggccgccagccccgccagccagccgacactcagt
attgatgcggtaaccggcgatgattatatcaaccgatctgaggcggcgcagggcattagc
atcagcggctctgctaccgggctggagaccggccaaacggtcacggttacgctcaacggt
caaaattacaccaccacggtcactgcacagggcgactggcgcgttgatgttccggcgcag
gccttggggcaactgagcgatggtaggcaaaccattaccgttaccgccagcgatgtggcg
ggtaatccggcgagcgccacgcatgacgttacggtagtcgccggggcagccagccagccg
gtcattgagatcaatacagtggcgggcgatgatgtggttaatgcccaggaagcgcagcag
ccactggtcattagcgggaccagccaacatctcgacgacggcgcgtctatcactgtcagt
ctgaatggtaaaacctattcggcaacggtggatgcggaaggaaactggagcgccaccgta
ccagcgcaggatgtacaggcactcactcaaggtgataatcacgttactgcgacggcgacc
gatattgccggtaacccggcggatgacagccacgatttcagcgtagatacccagccgcca
gcgttgctggacattgatttgggcgttgggagcgatggcatactgaatctggcggaagcg
gtcgccgggatcaccatcggcggcaccacggatgcaggactcactgtcacgctgacgtta
aatgataaaacctataccgccaccgccgatacgcaaggtcattggagcgttgcgctatcc
agcggggatttgttggcgctcgccgacggaacggcgcaggtggggctttcggtgaccgac
gccagcggcaacaccgcctctcaattggtggacctcaatgtcgcgataaatactctaccg
gccctgaccctcgacacgccattatttggcgatggcttactcaacgtggcggaagccgac
ggcgccctaaccctcaccggtacggcaacccatttagagccgggcactgaagttactgtc
acgattggcaatctgacctttagcggtacggttgctacgggtggcagatgggaggtgtca
atcccggccggggcactgagcgccttaccggatggcaatgtacaggttgaggtcagtgcg
gtcgatgcggcaggcaacccggctggcattgccggtaacgttgagattgtattgtcgacg
ttaccggaggcggcaatacaggttccgtttgttgatggcgcgctgaatgccgcagaagcg
gatagcgatcaggttattcgcggcaccaccgggattagcggcgaagggcagcaggttagc
gtggtgattaccgggctgaataatgaccaacccttaaccgctaccgttgatgccggcggc
cattggtcgttgaatctgtcaccgtcgcaactggcggatctggcaaacggtagccatacc
attacggctacggtgaccgatcgggcgggaaacagtgatagcgcctcgcttgacttcaac
tcaattattaacggcttacccgacccaacgctgaacacgccctttaccgatggcattctc
aacctgaccgaggcgcaggccggtggcgcactgagtggcgtgaccggtattaccggcgaa
cagaccgtgattgtcacggtgaatggcacaggttttgaggccacggttgatgaggaaacc
gggcagtggtcgcttgatttaccggccagcgagttgcaaacgctgccggatggtaactgg
ccgattgaagtctccgtcactgacagcgtcggcaacagcgcgacgattgatggggcatta
caggtcgctatccatacattgccggttgtcaccattaatctgccgtttggcgacggctcg
ctaaatattattgaagcgaccctcgatcaacagattaccgggcgcaccggtattaccagc
gccggtcaaacggtgagtgtggtcatctccgggctgaataatggcgacccatttgaggcc
agtgtagacgctaacggcaactggtcgctgaacctgtcgccgcaacagttagcgtcgtta
agcgatggtacgcacaccattgaggttaccgccacggatgcggcgggtaacagtgcgact
caatcgttggaggtgattgcggcgctgacgccagccgatccggtcattaacccaccgttt
ggcgatggcattcttaacattgacgaagcggcgggtgcggtaatcttaaccggcactact
gggctgagcggcgagaaccaaggcgtgcaaatcaccatcgacttgggcgggatcacctat
accggtacggtggatgcggaaggtaactggtcggttgggataccggccggggcgctaggt
aacctgaacaacggcacgcataccattgacctgacgatagtcgatgcggccggtaacgta
accaatgactcgctggtatttactgccgccctgaccgcgccaacgccgacgctgaatgtg
ccgtttggcgatagcctaatcaatctgcaggatgtggaagacggcgccaccttaaccgga
accaccggcaccaccggcgatgcacagagtgtaacggtcaacgtgggcggcacagactat
accgctaccctcaacggtgatggcagttggtcactggccctgtcttctgaacaacttaac
ttactggatcaaggcgacaataccttgtcggtgcgggtggttgatagtaacggcaatgca
acgacgattggcggcaatttcaccgtcgataccgtcgcgcccacggtcaatatcgatccg
ttcaccggcgacaacagcctcacctatgcggaaagtattctggcgcaaaccctcagcggt
agcgccggggttgaaaatgccggttccacggtaacagtgacgcttggcgcatcaacattg
accggcattgttgatgacgaggggaactggcaagttgccgtgatgcctggcgtgatggcg
caactggcgaatggtagcgacaccatcactgtaacgattaccgatccggcgggtaacagt
aacagtgccagcaccacgctaaccgttgatcttacaccgccggacgatccgttactgacg
ttggatcccatcggcggtgacaacattcttaatgcgtcggagaccggctcagtcactgta
accgggtcgtttagtcacttccttgtcggtagcacggtaaacatcacggtgaatggggtg
ctggtggggaccgatgtagtggtcggtagtgaagggaactggagcgttaaccttcctgct
gcgatatttggcagcgacggtaactacacggtctccgccagcgcggtagttgggctggat
acggtttctaccggcgcaacggtagtggtggatcgcaccgcgccagagctgacgattaac
gcctttaccgccgataatgtgctgaatgagagtgaaagcggcgtaacccaaacgctcagc
ggcaccgcctcgatcagcgaagccggtcgtaccgtaacgctgacgttgaacggcaaaacc
tatacggcggttgtgcaggcgaatgggaactggagcaccaacatcgcggcggcggattta
caggcgttgcaagatggcccgcaaacccttcatgccagcttaagcgatcgcgccggtaat
ctcagcgaggtggatcataacttcaccgtggataccggggcgccgctgctacaggttgat
gcgctgctgggcaataacgttctcaacgcggcggatattctcctcacccaaaccctaacc
ggcactgcctccggcgcggaagggcaaaccattgggctgtatcttggcgatgccaatcca
atcgctacggcggtggtgaatgcggacggtacctttgcgttgcaactaacgccggaggtg
ttagatagcctgaccgagggagcgctggtgtttggcgtgcgggtgagcgatgccgctggc
aaccaaactgacgccacgctgacggtcaataaaatcatcaatcaggggctaacgctgatt
gtagattctgtcttcggcgacggtacgctgagcgcgctggatagtacggtggcgcaaact
atctccggggtcgccaaactggcggggattggtgccacggtcacgctggatattggcgac
accaccctatcggcgaaagtggggcaggatggcaaatgggcgattatcgtgccgccaaac
atcctcggcctactggcagacggagatattaacctcaacttaaccctgtccgatgccgcc
ggtaacacgcgtaccgtgggtgaaaccgtgacggcaatcatccataacttgccggtgatt
ggcgacctatcgcacctgttcggtgtggacaacttgctcaatattggcgaccttgcccag
aaccaaacgattggcggcctgttaaatgcggcgaccggctcgacggtgattgtgacgtta
ggaagcaaatcgtaccaaacacaggtgaccgccggtggtcagtggggattaaccattccg
gcgctggatttaggacatttgctggatgggaccttatcgctgggcgtgaaagtgattgac
ccggcgggcaacgtcgcctcgtcagcggtggatgtgggtattttcggcaccgcgccttcg
atctcactgagcccgatcttcggcgacggtattcttaacgcactggatctggtgacaggt
caaaccattagcggcgtggtgaatcatgttgcggcgggcgctcaggtgaccatcagcatt
ggcaacagcaccgtaacggcggtggtcggccaaaacggcgcgttcagcgcgaccgtgagt
ccggatattttgggcaccttgctgaacggtaacctgacggtcggcgtcagcgtgactgat
gctgccggcaataccacctcgaccagtgccggtttggtggtgaatgtcaccatccccggt
atcgaactgaacccgatctttggcgacggcttattaaacgcggcggatgcgttactgacg
caggtgattagcgggcacattaccaatgctacgccaggctcgaaggtcgaggtgacgctc
gccggacaacacctgattaccaccgcgaacgccaatggtgactttagcgtagcgctctcg
cccgccattctgcaggggctgttggacggtaacctgacggttggcattaaagtcactgac
agtgcgggcaatagcgccgaaaccagcgcaggcgttaaggtcggtatccacaacttgccg
gttattacccttgatccgctgttcggcgacggtgtgctgaacctgctggaatcgatagcg
acacaaactatcactggtcaggtcgccaatgcggcggccggttcagtggtcaccgtcaat
atcggtaattcaactgtcaccgcagcggtagatgacaccggtcacttcagcgcacaggtc
tcgccggacattctcggtacgctgctgaatggcaacctcaccgtgggtgtctcggtgacg
gatgcggtagggaacaccgccagcgtcagcgccggggtacagattggcatcaatacgccg
ccaaccttaaccgtgaataccctgtttggcgacggcgtattaagcgcggttgatctgaac
agcgcgcaaaccatcagcggcagcagcagccatttaagtaatggcacgctggtgacggta
acgctgggcggaaaaacctataccgctcaggttggcagcaacgggaactggacgctgagt
gtaccgaaagccgatttggcgctgttaagcgatggtacgttagcggtcgaggtgcgcgct
accgatgcctttggcaacgaggcaaccggcagcggcgcgctgaatgttattgcacatacg
ccgccgaccgtaacgattgccacgatttttggcgacgggcagctcaatgcgaccgatgtg
ttgagcgcgcaaactattgtcggtacgtcgaccaatgcggaaggctcaaccatccaggtg
gcgattggcggccagacgtttaccgggacggttggggccgatggatcgtggagcgtatcg
gtaccggccgccagcctggcgacgattgccgatggcacgcaaaccgtgaccgccagcgtc
accaatcttgccggtggaaccggtagcgatgccggtaacctgttggtgggtacccatacg
ctgccttcggtgacgctgggaaccttgtttggcggtgatggcttcctcaatctggcggaa
gccgccaacggcgaaacgattagcggcaacgcaaccaatgcgcaaggcagtagcgtagcg
gtgaccatcgccggaaccaccttcaccaccacggtgggcgcggagggtagctggagcatc
actattccggccgaaaccttgcaagctctctccgacggcagccattcgctctcggtcacg
ctgaccgatgcggttggcaatatctcaaccgcgaacagtagttttaacgcggtaacgcat
aacctgccgattatcggtgtcgatccggtattaagcctggtcagcgtattgttgaccggt
ttaaccatctcgggcgggacgttgaacctgaagcagggcaccatgcttaacgtgacgctg
aatggacacactcagcaaaccaccactgatgccctcgggcgttacagcattaaattcgcc
gggggattactgaccgcgctcagcctcagctcgattgtaacggtaacggcggtggatgct
gcgggtaacccggcagccaccagcaccacactgttgctgggatcattattaccggttgcc
gccagcgcagaggtacacagcgctgcgctggtcgctgttgatgatagcggaaccgcctcg
gctggcgatcaaagtcacagcgtggccgcgccgacggcaagtgagcaaaaatcgacggca
gagagcgcgcataccgaggcggttccggttgcgtcgacgctggttaccgagacagatagc
gccgcactgtcggtaagtgatacgcacgcgctcaacgcgccggtggcgcatggcgcatcg
ccaactgagagcacggcggatgaggcttactccatcggcggcgtcaccatcgtactggct
gacggttcaatgcaagagggtgcttttatcaccgggagccagggtgaggataccgtgacg
cttaatacgttgaactttggtcatattgatggcggtagcggcgtcgatacgctggtgtta
aatggcgagcatatgacgttggatctcacctcgctggggctaaaaatcgagaatgttgag
gtgctcgacctcggtaagtctggtactaacggcattaagctcgatctgcatgacgcactg
accctgaccgatacgccgcaagacgatctgttgattaagggggccgatggcggcgaggtg
acgctagcgaataccgagggcggcgtatggagcagtaccggccagcgtaccgttgagggg
cacacctatgacgtgtaccacaactcggcacttactgcggacaacaccttaggcgatgtg
ttgattcagcataatttacaggtgcacgtggtgtaa
DBGET
integrated database retrieval system