Pseudomonas marincola: PMYSY11_1998 Help Entry PMYSY11_1998      CDS       T07318                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmao  Pseudomonas marincola Pathway pmao01100   Metabolic pathways pmao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PMYSY11_1998 (acpP)    00074 Mycolic acid biosynthesis     PMYSY11_1998 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PMYSY11_1998 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  CAE6913072 LinkDB All DBs Position PMYSY11:2059689..2059925 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITSVQEAIDYVTAHAS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcagcttggcgtaaaagaa gaggaagtaaccaacagcgcttccttcgtcgaagacctgggtgctgactctcttgacacc gttgagctggtaatggccctcgaagaagagttcgagaccgaaatcccggacgagcaagct gagaagatcactagcgttcaggaagctatcgactacgttactgctcacgcatcgtaa

DBGET integrated database retrieval system