Pseudomonas marincola: PMYSY11_3354
Help
Entry
PMYSY11_3354 CDS
T07318
Symbol
thrC
Name
(GenBank) Threonine synthase
KO
K01733
threonine synthase [EC:
4.2.3.1
]
Organism
pmao
Pseudomonas marincola
Pathway
pmao00260
Glycine, serine and threonine metabolism
pmao00750
Vitamin B6 metabolism
pmao01100
Metabolic pathways
pmao01110
Biosynthesis of secondary metabolites
pmao01120
Microbial metabolism in diverse environments
pmao01230
Biosynthesis of amino acids
Module
pmao_M00018
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:
pmao00001
]
09100 Metabolism
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
PMYSY11_3354 (thrC)
09108 Metabolism of cofactors and vitamins
00750 Vitamin B6 metabolism
PMYSY11_3354 (thrC)
Enzymes [BR:
pmao01000
]
4. Lyases
4.2 Carbon-oxygen lyases
4.2.3 Acting on phosphates
4.2.3.1 threonine synthase
PMYSY11_3354 (thrC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Thr_synth_N
PALP
THR4_C
Motif
Other DBs
NCBI-ProteinID:
CAE6935964
LinkDB
All DBs
Position
PMYSY11:complement(3495094..3496503)
Genome browser
AA seq
469 aa
AA seq
DB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVTGSIPDADFKKILEETYGVFAHNAVAPLRQLNSNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLEKRGERVVIMGATSGDTGSAAIEGCRRCENVDIFILHPHNRVSEVQRRQMTTI
MGENIHNIAVEGNFDDCQEMIKDSFADQSFLKGTRLVAVNSINWARIMAQIVYYFHASLQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPISQLIVATNRNDILHRFMSGNQYVKETL
HPTLSPSMDIMVSSNFERLLFDLHGRNGASIAELMANFKQGGGFSIEDDRWTEARKLFDS
LAVDDQATCETITEVFNECGELLDPHTAIGVRAARECRRSLAVPMVVLGTAHPVKFPDAV
EKAGVGESPTLPAHLADLFERDERCTVLANDLKAVQGFVAAHGNRGKPL
NT seq
1410 nt
NT seq
+upstream
nt +downstream
nt
atgcgttatatcagtactcgcggccaggccccggccctgaatttcgaagatgtgctgctg
gcaggtctcgccagcgacggcggcctgtacgtgccagagaacctgccacgtttcacccag
gaagaaatcgcttcctgggctggcctgccgtatcacgaactggctttccgcgtgatgcgc
ccgttcgtaaccggcagcattccggatgccgacttcaagaaaatccttgaagaaacctac
ggcgtatttgcccacaatgcggtcgcgccattgcgtcagctgaacagcaacgagtgggtg
ctcgaactgttccacggcccgaccctggcgtttaaagacttcgcgctgcagctgctcggt
cgcctgctcgattacgtgcttgagaagcgcggcgagcgcgtggtgatcatgggcgcaacc
tccggcgataccggttcggctgcgattgaaggctgccgccgttgcgaaaacgtcgacatc
ttcatcctgcacccgcacaaccgcgtctcggaagttcagcgtcgccagatgaccaccatc
atgggcgagaacatccacaacatcgccgttgagggtaacttcgacgattgccaggagatg
atcaaggacagctttgctgaccagagcttcctcaagggcacgcgactggttgccgtgaac
tcgatcaactgggcgcggatcatggcccagatcgtttactacttccacgcctccctgcag
cttggcggcccggcgcgctcggtcgcgttctcggtgccaaccggcaacttcggtgacatc
ttcgcgggttacctcgcacgtaacatgggcctgccgatcagccagttgatcgttgcgacc
aaccgtaacgacatcctgcaccgcttcatgagcggcaatcagtacgtcaaagagacgctg
cacccgaccttgtcgccgtcgatggacatcatggtgtcgtcgaacttcgaacgcttgctg
ttcgacctgcacggtcgcaacggcgcgtcgattgccgagttgatggccaacttcaagcag
ggcggtggtttcagcatcgaagatgatcgctggaccgaagcccgcaagctgttcgattcg
ctggctgtggatgatcaggcaacctgcgaaaccatcaccgaagtgttcaacgagtgcggc
gaattgctcgacccgcacaccgcaatcggcgtgcgcgccgcccgtgaatgccgtcgcagt
ctggctgtgccgatggtggttctgggcacggcgcatccggtcaagttcccggatgccgtt
gagaaggcaggtgtcggcgagtcgcctacattgccggcgcatctcgccgacttgttcgag
cgcgatgagcgttgcaccgtgctggccaacgacctgaaagccgtgcagggcttcgttgcc
gcacatggcaatcgcggtaagccactgtaa
DBGET
integrated database retrieval system