Pseudomonas marincola: PMYSY11_4096 Help Entry PMYSY11_4096      CDS       T07318                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pmao  Pseudomonas marincola Pathway pmao01100   Metabolic pathways pmao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PMYSY11_4096    00074 Mycolic acid biosynthesis     PMYSY11_4096   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PMYSY11_4096 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAE6948500 LinkDB All DBs Position PMYSY11:4342937..4343197 Genome browser AA seq 86 aa AA seqDB search MSELQHEIKNLIIDSLGLEDMSAEDIATDQPLFGDGLGLDSVDALELGLAIQKRFGIKID AEDKDTRQHFANVANLAAFVSARQAV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgaattacaacacgaaattaaaaacctgattatcgactcgctggggctcgaagac atgtcggctgaagacatcgcgaccgaccagccgctgtttggtgatggcttgggcctcgac tcagtggatgccctcgaactggggctggcgatccagaaacgctttggcatcaagatcgat gcagaggacaaggacacgcgccaacacttcgccaatgtggccaacctggcggcttttgta tctgcacgccaggccgtttga

DBGET integrated database retrieval system