KEGG   Planococcus sp. Y42: B0X71_12095
Entry
B0X71_12095       CDS       T04763                                 
Name
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
pmar  Planococcus sp. Y42
Brite
KEGG Orthology (KO) [BR:pmar00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    B0X71_12095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pmar03019]
    B0X71_12095
   03009 Ribosome biogenesis [BR:pmar03009]
    B0X71_12095
   03036 Chromosome and associated proteins [BR:pmar03036]
    B0X71_12095
Enzymes [BR:pmar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     B0X71_12095
Messenger RNA biogenesis [BR:pmar03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     B0X71_12095
Ribosome biogenesis [BR:pmar03009]
 Eukaryotic type
  90S particles
   RNase
    B0X71_12095
 Prokaryotic type
  rRNA processing factors
   B0X71_12095
Chromosome and associated proteins [BR:pmar03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     B0X71_12095
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm RM44_endonuclase DSRM_2 Phage_P2_GpU DND1_DSRM
Other DBs
NCBI-ProteinID: AQQ55108
UniProt: A0A1Q2L3S1
LinkDB
Position
complement(2343851..2344603)
AA seq 250 aa
MSMKRKKEHQPGVLPEEARTSFERLQQELGITFKQPTLLYQAFTHSSYVNEHRKRYYTDN
ERLEFLGDAVLELSVSHYLFKHYPKMSEGELTKLRAAVVCEPSLVLFANELDFGRYVLLG
KGEELTGGRERPALLADAFESFVGALYLDQGLEPVVQFLERVLFPKVEIGAFSHVMDYKS
QLQELIQQKNRGPLVYEIVEEKGPAHNRTFVTEVALDSQVLGTGEGRSKKEAEQQAAMVA
IRKLQGNTEG
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtcgatgaaacgaaaaaaagaacatcagccgggagtgctcccggaagaagcccgcacg
tcatttgagcgactgcagcaggagctcggcatcacatttaagcagccgacgctgctttat
caagcttttacccattcatcttatgtgaatgagcatcggaaacggtattacactgacaat
gaacgtcttgaatttctcggggatgctgttctggagttatccgtatcccattacctgttc
aaacattatccgaaaatgagcgaaggggagctgaccaagctgcgcgctgcagtcgtatgc
gaaccttctcttgtgctgtttgccaatgagttggatttcggacggtatgttcttcttggc
aaaggagaagaactgacaggggggcgcgaacgtccggcacttcttgccgatgcgtttgaa
tcgttcgtgggtgccttatacctggatcaggggctggaaccggtcgtgcagtttttggag
cgtgttctgtttccgaaagttgaaatcggtgctttttcgcatgtgatggactataagagc
caactgcaggaattgatccagcagaaaaaccgcgggccgcttgtctatgaaattgtggaa
gaaaaagggccggcccataaccggacgtttgtaacagaggtagcactggacagccaggtg
ctcggcacgggtgaagggcgttcaaaaaaagaagcagaacagcaggcagcgatggtcgct
atccgtaaactgcagggaaatacggagggctga

DBGET integrated database retrieval system