Paracoccus marcusii: CP157_01706 Help Entry CP157_01706       CDS       T07681                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pmau  Paracoccus marcusii Pathway pmau01100   Metabolic pathways pmau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP157_01706 (acpP_1)    00074 Mycolic acid biosynthesis     CP157_01706 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP157_01706 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QXI63972 LinkDB All DBs Position complement(1688075..1688341) Genome browser AA seq 88 aa AA seqDB search MTDDITQRIRAIIAEQAMLEPDQITDNATPAELGIDSLGLVESIFAIEEEFDISIPFNAN EPEKSDFDISNMGTIIAAVHRLVAEKAE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgacagacgacatcacgcagcgcattcgggccatcatcgcggaacaggcgatgctggaa cccgaccagatcaccgataacgcgacccccgccgagctcggcatcgacagcctgggcctg gtcgaatcgatctttgccatcgaggaagagttcgacatctcgatcccgttcaatgcgaac gagcccgagaagtccgacttcgacatctcgaacatgggcacgatcatcgccgcggtgcat cggctggtcgcggaaaaggcggaatga

DBGET integrated database retrieval system