Paracoccus marcusii: CP157_02567 Help Entry CP157_02567       CDS       T07681                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pmau  Paracoccus marcusii Pathway pmau01100   Metabolic pathways pmau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP157_02567 (acpP_2)    00074 Mycolic acid biosynthesis     CP157_02567 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP157_02567 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QXI64792 LinkDB All DBs Position complement(2542140..2542373) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVDEDKVVESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTVGDAVTFIKGAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgatcgcgtgaagaagatcgtggtcgagcatctgggtgtcgacgag gacaaggtggtcgaatccgcttcgttcatcgacgacctgggtgccgacagcctcgacacc gtcgagctggtcatggcgttcgaggaagagttcgggatcgagatccccgacgatgccgcc gaaaccatccagaccgtcggcgacgcggtgaccttcatcaagggcgcggtctga

DBGET integrated database retrieval system