KEGG   Peromyscus maniculatus bairdii (prairie deer mouse): 102918009
Entry
102918009         CDS       T11302                                 
Symbol
Mapk1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pmav  Peromyscus maniculatus bairdii (prairie deer mouse)
Pathway
pmav01521  EGFR tyrosine kinase inhibitor resistance
pmav01522  Endocrine resistance
pmav01524  Platinum drug resistance
pmav04010  MAPK signaling pathway
pmav04012  ErbB signaling pathway
pmav04014  Ras signaling pathway
pmav04015  Rap1 signaling pathway
pmav04022  cGMP-PKG signaling pathway
pmav04024  cAMP signaling pathway
pmav04062  Chemokine signaling pathway
pmav04066  HIF-1 signaling pathway
pmav04068  FoxO signaling pathway
pmav04071  Sphingolipid signaling pathway
pmav04072  Phospholipase D signaling pathway
pmav04114  Oocyte meiosis
pmav04140  Autophagy - animal
pmav04148  Efferocytosis
pmav04150  mTOR signaling pathway
pmav04151  PI3K-Akt signaling pathway
pmav04210  Apoptosis
pmav04218  Cellular senescence
pmav04261  Adrenergic signaling in cardiomyocytes
pmav04270  Vascular smooth muscle contraction
pmav04350  TGF-beta signaling pathway
pmav04360  Axon guidance
pmav04370  VEGF signaling pathway
pmav04371  Apelin signaling pathway
pmav04380  Osteoclast differentiation
pmav04510  Focal adhesion
pmav04517  IgSF CAM signaling
pmav04520  Adherens junction
pmav04540  Gap junction
pmav04550  Signaling pathways regulating pluripotency of stem cells
pmav04611  Platelet activation
pmav04613  Neutrophil extracellular trap formation
pmav04620  Toll-like receptor signaling pathway
pmav04621  NOD-like receptor signaling pathway
pmav04625  C-type lectin receptor signaling pathway
pmav04650  Natural killer cell mediated cytotoxicity
pmav04657  IL-17 signaling pathway
pmav04658  Th1 and Th2 cell differentiation
pmav04659  Th17 cell differentiation
pmav04660  T cell receptor signaling pathway
pmav04662  B cell receptor signaling pathway
pmav04664  Fc epsilon RI signaling pathway
pmav04666  Fc gamma R-mediated phagocytosis
pmav04668  TNF signaling pathway
pmav04713  Circadian entrainment
pmav04720  Long-term potentiation
pmav04722  Neurotrophin signaling pathway
pmav04723  Retrograde endocannabinoid signaling
pmav04724  Glutamatergic synapse
pmav04725  Cholinergic synapse
pmav04726  Serotonergic synapse
pmav04730  Long-term depression
pmav04810  Regulation of actin cytoskeleton
pmav04910  Insulin signaling pathway
pmav04912  GnRH signaling pathway
pmav04914  Progesterone-mediated oocyte maturation
pmav04915  Estrogen signaling pathway
pmav04916  Melanogenesis
pmav04917  Prolactin signaling pathway
pmav04919  Thyroid hormone signaling pathway
pmav04921  Oxytocin signaling pathway
pmav04926  Relaxin signaling pathway
pmav04928  Parathyroid hormone synthesis, secretion and action
pmav04929  GnRH secretion
pmav04930  Type II diabetes mellitus
pmav04933  AGE-RAGE signaling pathway in diabetic complications
pmav04934  Cushing syndrome
pmav04935  Growth hormone synthesis, secretion and action
pmav04960  Aldosterone-regulated sodium reabsorption
pmav05010  Alzheimer disease
pmav05020  Prion disease
pmav05022  Pathways of neurodegeneration - multiple diseases
pmav05034  Alcoholism
pmav05132  Salmonella infection
pmav05133  Pertussis
pmav05135  Yersinia infection
pmav05140  Leishmaniasis
pmav05142  Chagas disease
pmav05145  Toxoplasmosis
pmav05152  Tuberculosis
pmav05160  Hepatitis C
pmav05161  Hepatitis B
pmav05163  Human cytomegalovirus infection
pmav05164  Influenza A
pmav05165  Human papillomavirus infection
pmav05166  Human T-cell leukemia virus 1 infection
pmav05167  Kaposi sarcoma-associated herpesvirus infection
pmav05170  Human immunodeficiency virus 1 infection
pmav05171  Coronavirus disease - COVID-19
pmav05200  Pathways in cancer
pmav05203  Viral carcinogenesis
pmav05205  Proteoglycans in cancer
pmav05206  MicroRNAs in cancer
pmav05207  Chemical carcinogenesis - receptor activation
pmav05208  Chemical carcinogenesis - reactive oxygen species
pmav05210  Colorectal cancer
pmav05211  Renal cell carcinoma
pmav05212  Pancreatic cancer
pmav05213  Endometrial cancer
pmav05214  Glioma
pmav05215  Prostate cancer
pmav05216  Thyroid cancer
pmav05218  Melanoma
pmav05219  Bladder cancer
pmav05220  Chronic myeloid leukemia
pmav05221  Acute myeloid leukemia
pmav05223  Non-small cell lung cancer
pmav05224  Breast cancer
pmav05225  Hepatocellular carcinoma
pmav05226  Gastric cancer
pmav05230  Central carbon metabolism in cancer
pmav05231  Choline metabolism in cancer
pmav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pmav05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pmav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102918009 (Mapk1)
   04012 ErbB signaling pathway
    102918009 (Mapk1)
   04014 Ras signaling pathway
    102918009 (Mapk1)
   04015 Rap1 signaling pathway
    102918009 (Mapk1)
   04350 TGF-beta signaling pathway
    102918009 (Mapk1)
   04370 VEGF signaling pathway
    102918009 (Mapk1)
   04371 Apelin signaling pathway
    102918009 (Mapk1)
   04668 TNF signaling pathway
    102918009 (Mapk1)
   04066 HIF-1 signaling pathway
    102918009 (Mapk1)
   04068 FoxO signaling pathway
    102918009 (Mapk1)
   04072 Phospholipase D signaling pathway
    102918009 (Mapk1)
   04071 Sphingolipid signaling pathway
    102918009 (Mapk1)
   04024 cAMP signaling pathway
    102918009 (Mapk1)
   04022 cGMP-PKG signaling pathway
    102918009 (Mapk1)
   04151 PI3K-Akt signaling pathway
    102918009 (Mapk1)
   04150 mTOR signaling pathway
    102918009 (Mapk1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102918009 (Mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102918009 (Mapk1)
   04148 Efferocytosis
    102918009 (Mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102918009 (Mapk1)
   04210 Apoptosis
    102918009 (Mapk1)
   04218 Cellular senescence
    102918009 (Mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102918009 (Mapk1)
   04520 Adherens junction
    102918009 (Mapk1)
   04540 Gap junction
    102918009 (Mapk1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102918009 (Mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102918009 (Mapk1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102918009 (Mapk1)
   04613 Neutrophil extracellular trap formation
    102918009 (Mapk1)
   04620 Toll-like receptor signaling pathway
    102918009 (Mapk1)
   04621 NOD-like receptor signaling pathway
    102918009 (Mapk1)
   04625 C-type lectin receptor signaling pathway
    102918009 (Mapk1)
   04650 Natural killer cell mediated cytotoxicity
    102918009 (Mapk1)
   04660 T cell receptor signaling pathway
    102918009 (Mapk1)
   04658 Th1 and Th2 cell differentiation
    102918009 (Mapk1)
   04659 Th17 cell differentiation
    102918009 (Mapk1)
   04657 IL-17 signaling pathway
    102918009 (Mapk1)
   04662 B cell receptor signaling pathway
    102918009 (Mapk1)
   04664 Fc epsilon RI signaling pathway
    102918009 (Mapk1)
   04666 Fc gamma R-mediated phagocytosis
    102918009 (Mapk1)
   04062 Chemokine signaling pathway
    102918009 (Mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102918009 (Mapk1)
   04929 GnRH secretion
    102918009 (Mapk1)
   04912 GnRH signaling pathway
    102918009 (Mapk1)
   04915 Estrogen signaling pathway
    102918009 (Mapk1)
   04914 Progesterone-mediated oocyte maturation
    102918009 (Mapk1)
   04917 Prolactin signaling pathway
    102918009 (Mapk1)
   04921 Oxytocin signaling pathway
    102918009 (Mapk1)
   04926 Relaxin signaling pathway
    102918009 (Mapk1)
   04935 Growth hormone synthesis, secretion and action
    102918009 (Mapk1)
   04919 Thyroid hormone signaling pathway
    102918009 (Mapk1)
   04928 Parathyroid hormone synthesis, secretion and action
    102918009 (Mapk1)
   04916 Melanogenesis
    102918009 (Mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102918009 (Mapk1)
   04270 Vascular smooth muscle contraction
    102918009 (Mapk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102918009 (Mapk1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102918009 (Mapk1)
   04725 Cholinergic synapse
    102918009 (Mapk1)
   04726 Serotonergic synapse
    102918009 (Mapk1)
   04720 Long-term potentiation
    102918009 (Mapk1)
   04730 Long-term depression
    102918009 (Mapk1)
   04723 Retrograde endocannabinoid signaling
    102918009 (Mapk1)
   04722 Neurotrophin signaling pathway
    102918009 (Mapk1)
  09158 Development and regeneration
   04360 Axon guidance
    102918009 (Mapk1)
   04380 Osteoclast differentiation
    102918009 (Mapk1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102918009 (Mapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102918009 (Mapk1)
   05206 MicroRNAs in cancer
    102918009 (Mapk1)
   05205 Proteoglycans in cancer
    102918009 (Mapk1)
   05207 Chemical carcinogenesis - receptor activation
    102918009 (Mapk1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102918009 (Mapk1)
   05203 Viral carcinogenesis
    102918009 (Mapk1)
   05230 Central carbon metabolism in cancer
    102918009 (Mapk1)
   05231 Choline metabolism in cancer
    102918009 (Mapk1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102918009 (Mapk1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102918009 (Mapk1)
   05212 Pancreatic cancer
    102918009 (Mapk1)
   05225 Hepatocellular carcinoma
    102918009 (Mapk1)
   05226 Gastric cancer
    102918009 (Mapk1)
   05214 Glioma
    102918009 (Mapk1)
   05216 Thyroid cancer
    102918009 (Mapk1)
   05221 Acute myeloid leukemia
    102918009 (Mapk1)
   05220 Chronic myeloid leukemia
    102918009 (Mapk1)
   05218 Melanoma
    102918009 (Mapk1)
   05211 Renal cell carcinoma
    102918009 (Mapk1)
   05219 Bladder cancer
    102918009 (Mapk1)
   05215 Prostate cancer
    102918009 (Mapk1)
   05213 Endometrial cancer
    102918009 (Mapk1)
   05224 Breast cancer
    102918009 (Mapk1)
   05223 Non-small cell lung cancer
    102918009 (Mapk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102918009 (Mapk1)
   05170 Human immunodeficiency virus 1 infection
    102918009 (Mapk1)
   05161 Hepatitis B
    102918009 (Mapk1)
   05160 Hepatitis C
    102918009 (Mapk1)
   05171 Coronavirus disease - COVID-19
    102918009 (Mapk1)
   05164 Influenza A
    102918009 (Mapk1)
   05163 Human cytomegalovirus infection
    102918009 (Mapk1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102918009 (Mapk1)
   05165 Human papillomavirus infection
    102918009 (Mapk1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102918009 (Mapk1)
   05135 Yersinia infection
    102918009 (Mapk1)
   05133 Pertussis
    102918009 (Mapk1)
   05152 Tuberculosis
    102918009 (Mapk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102918009 (Mapk1)
   05140 Leishmaniasis
    102918009 (Mapk1)
   05142 Chagas disease
    102918009 (Mapk1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102918009 (Mapk1)
   05020 Prion disease
    102918009 (Mapk1)
   05022 Pathways of neurodegeneration - multiple diseases
    102918009 (Mapk1)
  09165 Substance dependence
   05034 Alcoholism
    102918009 (Mapk1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102918009 (Mapk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102918009 (Mapk1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102918009 (Mapk1)
   04934 Cushing syndrome
    102918009 (Mapk1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102918009 (Mapk1)
   01524 Platinum drug resistance
    102918009 (Mapk1)
   01522 Endocrine resistance
    102918009 (Mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmav01001]
    102918009 (Mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmav03036]
    102918009 (Mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmav04147]
    102918009 (Mapk1)
Enzymes [BR:pmav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102918009 (Mapk1)
Protein kinases [BR:pmav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102918009 (Mapk1)
Chromosome and associated proteins [BR:pmav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102918009 (Mapk1)
Exosome [BR:pmav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102918009 (Mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase STATB_N FTA2 Kdo
Other DBs
NCBI-GeneID: 102918009
NCBI-ProteinID: XP_006993095
Ensembl: ENSPEMG00000013158
UniProt: A0A6I9MF87
LinkDB
Position
12:3578342..3647791
AA seq 357 aa
MAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQT
YCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSN
DHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGF
LTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGI
LGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIE
VEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgggcccggagatggtccgcgggcaggtgttcgacgtggggccg
cgctacaccaacctctcgtacatcggagagggcgcctacggcatggtctgctctgcttat
gataatctcaacaaagttcgagttgctatcaagaaaatcagtccttttgagcaccagacc
tactgccagagaaccctaagagaaataaaaatcttactgcgcttcagacatgagaatatc
atcgggatcaatgacatcatccgggcaccaaccattgagcagatgaaagatgtatatata
gtacaggacctcatggagacagatctttacaagctcttgaagacacaacacctcagcaat
gaccatatctgctattttctttatcagatcctgagaggattaaaatacatacattcagct
aacgttctgcatcgtgacctcaagccttctaacctcctgctgaacaccacttgtgatctc
aagatctgtgactttggccttgcccgtgttgcagatccggatcatgatcacacagggttc
ttgacagagtacgtagccacacgttggtacagagctccagaaatcatgttgaattccaag
ggttataccaagtccattgatatttggtctgtgggttgcatcctggcagagatgctctcc
aacaggcctatcttcccagggaagcattacctggaccagctgaatcacatcctgggtatt
cttggatctccatcacaggaagatctgaattgtataataaatttaaaagccagaaactac
ttgctttctcttccgcacaaaaataaggtgccgtggaacaggctgttcccaaatgctgac
tccaaagctctggacttactggataaaatgttgacatttaaccctcacaagaggattgaa
gttgaacaggctctggcccacccttacctggagcagtattatgacccaagtgatgagccc
attgctgaagcaccattcaagtttgacatggaattggatgacttacctaaggagaagctc
aaagaactcatttttgaagagactgctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system