Pecten maximus (king scallop): 117319627 Help Entry 117319627         CDS       T07399                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pmax  Pecten maximus (king scallop) Pathway pmax04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:pmax00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     117319627  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pmax01009]     117319627   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmax04131]     117319627    03036 Chromosome and associated proteins [BR:pmax03036]     117319627   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmax04147]     117319627 Protein phosphatases and associated proteins [BR:pmax01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      117319627 Membrane trafficking [BR:pmax04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     117319627 Chromosome and associated proteins [BR:pmax03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      117319627 Exosome [BR:pmax04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117319627 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH DUF2267 EF_EFCAB10_C Alpha_adaptin_C PrkC-like_PASTA-like HMG_box_2 Styelin Motif Other DBs NCBI-GeneID:  117319627 NCBI-ProteinID:  XP_033730289 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MRALGQNPTSQHVRSIIAEVDKDNDGEIDFEEFVSMMSKKWRDLEKEEEEIKKAFKVFDR NGDGMIEMRELKAVLTGLGERMTEEEFQDLMRGGPDPKRKGGHHIQK NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgcgagctttaggtcaaaatcctacgtcacaacatgtgcggtcaattatagcggaagtg gataaggacaacgatggtgagattgattttgaagaattcgtttctatgatgtcaaaaaaa tggcgtgacctagaaaaagaggaagaggaaataaagaaagctttcaaggtttttgacaga aatggagatggtatgattgaaatgcgtgaattgaaagctgtcctaactggtttgggtgaa aggatgacagaggaagaatttcaggatctcatgcgcggaggcccagaccctaaacggaaa ggggggcatcacatacaaaag

DBGET integrated database retrieval system