Pecten maximus (king scallop): 117323356 Help Entry 117323356         CDS       T07399                                  Name (RefSeq) ADP-ribosylation factor 1-like   KO K07937   ADP-ribosylation factor 1/2 Organism pmax  Pecten maximus (king scallop) Pathway pmax04144   Endocytosis Brite KEGG Orthology (KO) [BR:pmax00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117323356  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmax04131]     117323356   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmax04147]     117323356    04031 GTP-binding proteins [BR:pmax04031]     117323356 Membrane trafficking [BR:pmax04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     117323356   Arf GTPases and associated proteins    Arf GTPases     117323356  Endosome - Golgi transport     117323356 Exosome [BR:pmax04147]  Exosomal proteins   Proteins found in most exosomes    117323356 GTP-binding proteins [BR:pmax04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     117323356 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc G-alpha Ras Gtr1_RagA SRPRB 6PF2K Motif Other DBs NCBI-GeneID:  117323356 NCBI-ProteinID:  XP_033734422 LinkDB All DBs Position 3:16091039..16091752 Genome browser AA seq 108 aa AA seqDB search MGLLLAKLADVMQSFSSGTTTRILMLGLDAAGKTTVLYKIKLNENVCTIPTIGFNVEEVS PCKGVSFTVWDVGGQEKIRALWRHYFQNTEGKLSLWYIYGAENIDFFV NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgggtttgttattggctaaactcgctgatgtgatgcaaagtttctcaagtggaaccacc acccggattctgatgctgggattagatgcggcaggaaaaactacggtcctgtacaagatc aaattaaacgagaatgtatgtaccatcccgacgatcggatttaacgtagaggaggtgtcc ccgtgtaagggtgtatccttcactgtgtgggacgtcggcggtcaggagaaaatccgggct ctctggagacactatttccaaaacacggaaggtaagctgtctttatggtatatatatgga gcagagaatatagatttttttgtttga

DBGET integrated database retrieval system