Pecten maximus (king scallop): 117324674 Help Entry 117324674         CDS       T07399                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pmax  Pecten maximus (king scallop) Pathway pmax04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:pmax00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     117324674  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pmax01009]     117324674   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmax04131]     117324674    03036 Chromosome and associated proteins [BR:pmax03036]     117324674   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmax04147]     117324674 Protein phosphatases and associated proteins [BR:pmax01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      117324674 Membrane trafficking [BR:pmax04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     117324674 Chromosome and associated proteins [BR:pmax03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      117324674 Exosome [BR:pmax04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117324674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH DUF5580_M SPARC_Ca_bdg EF_EFCAB10_C Dockerin_1 EFhand_Ca_insen FCaBP_EF-hand Motif Other DBs NCBI-GeneID:  117324674 NCBI-ProteinID:  XP_033736503 LinkDB All DBs Position 3:complement(7357971..7360033) Genome browser AA seq 114 aa AA seqDB search MRALGQNPTEAELQDMINEADADGSGCIEFPEFLTMMSKKGLKSEDPEEDLRKAFNVFDQ DGNGFLTADELRHVMLNLGEKLSLAEAEEMIREADIDGDGQIDYKEYVKMMTSV NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagggcactaggtcagaacccgacggaagctgagttacaggacatgatcaacgaagcg gacgctgatggcagcggttgcatcgaatttcccgaattcctcaccatgatgtccaaaaag gggctaaaaagtgaggatcccgaggaggacttacgaaaagcctttaatgtatttgatcaa gatggaaacggcttccttaccgcagacgaattaagacacgtaatgctgaatttaggcgaa aaattatcactggctgaagcagaggaaatgatacgagaagcggatatagacggtgatgga caaatagattacaaagaatacgtgaaaatgatgacgtcagtgtga

DBGET integrated database retrieval system