Pecten maximus (king scallop): 117333550 Help Entry 117333550         CDS       T07399                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism pmax  Pecten maximus (king scallop) Pathway pmax04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pmax00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117333550  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pmax04121]     117333550    03400 DNA repair and recombination proteins [BR:pmax03400]     117333550 Ubiquitin system [BR:pmax04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117333550    Cul5 complex      117333550 DNA repair and recombination proteins [BR:pmax03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117333550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD TDP-43_N Motif Other DBs NCBI-GeneID:  117333550 NCBI-ProteinID:  XP_033748778 LinkDB All DBs Position 8:complement(41851680..41858418) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRRKCTIFTDAKESTTVHEVKKIIEGILKTRPDDQKLYKDDQPLDDNKTLGDY GFTFATARAQAPATIGLAFRQEDGEFEALEVTPLSSPPELPDVMKPQDSTSHAQEQTAS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttttaatgataaggcgcaggaagtgtaccatcttcactgatgcaaaggag tctaccacagtacatgaagtaaagaaaataatagagggtatactaaaaaccagaccagat gatcagaagctttataaagatgaccagcccttagatgacaataaaacacttggtgattat ggattcacatttgccacagcaagagcacaggcaccagcaacaattggtttggcttttaga caggaagatggagaatttgaagctttggaagtgacaccattgtccagtcccccagaactc ccagatgtcatgaagccacaagattccacttcacatgcacaagaacaaacagcatcgtaa

DBGET integrated database retrieval system