Pecten maximus (king scallop): 117343270 Help Entry 117343270         CDS       T07399                                  Name (RefSeq) sepiapterin reductase-like   KO K00072   sepiapterin reductase [EC:1.1.1.153] Organism pmax  Pecten maximus (king scallop) Pathway pmax00790   Folate biosynthesis pmax01100   Metabolic pathways pmax01240   Biosynthesis of cofactors Module pmax_M00842   Tetrahydrobiopterin biosynthesis, GTP => BH4 Brite KEGG Orthology (KO) [BR:pmax00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     117343270  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmax04147]     117343270 Enzymes [BR:pmax01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.153  sepiapterin reductase (L-erythro-7,8-dihydrobiopterin-forming)      117343270 Exosome [BR:pmax04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    117343270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  adh_short adh_short_C2 Motif Other DBs NCBI-GeneID:  117343270 NCBI-ProteinID:  XP_033761506 LinkDB All DBs Position 15:13737403..13739503 Genome browser AA seq 132 aa AA seqDB search MILLNTSFFTTFCDPSLSRIVVNITSGASRIPFPSLHLYCSGKAARDMFFRVLSAEEPSI RVLTYAPGFVDTYMLRDLEANSSSTPIRKLVNGFRQDGEILTPEATVADLERVLEDNAFE NADHVDYYHQTA NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgattctactcaacacgagcttctttacaacattttgtgatccgtctttgtctcgaatc gtggtcaacataacgtcaggggcttccaggattccatttccgtctctccacctgtattgc tcaggcaaagctgcccgtgatatgttcttccgagtcctttctgccgaagaaccatctatt cgggttctgacatacgccccaggttttgttgacacatatatgttgcgagatctagaagca aattcatcctcaactccaatccgtaaattggtaaatggctttcgtcaggacggcgaaata ctgacaccagaggcaactgtggccgaccttgaacgggtactggaggacaacgcgttcgaa aatgctgatcacgtggactactatcatcagacagcctag

DBGET integrated database retrieval system