Prochlorococcus marinus MIT 9515: P9515_03301 Help Entry P9515_03301       CDS       T00465                                  Symbol psbE Name (GenBank) Cytochrome b559 alpha-subunit   KO K02707   photosystem II cytochrome b559 subunit alpha Organism pmc  Prochlorococcus marinus MIT 9515 Pathway pmc00195   Photosynthesis pmc01100   Metabolic pathways Module pmc_M00161   Photosystem II pmc_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:pmc00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     P9515_03301 (psbE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pmc00194]     P9515_03301 (psbE) Photosynthesis proteins [BR:pmc00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     P9515_03301 (psbE) SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  ABM71539 UniProt:  A2BUS8 LinkDB All DBs Position 305128..305376 Genome browser AA seq 82 aa AA seqDB search MAAGSTGERPFFEIITSIRYWIIHAVTLPAIFIAGFLFVYTGLAYDAFGTPRPDSYFQAS ESKAPVVTQRYDAKSQLDLRTK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgcaggttcaacgggtgaacgccctttctttgaaataatcaccagtataagatac tggattattcatgcagtaacacttccagctatctttatagcgggatttctatttgtttac acaggcttagcctatgatgcatttgggactccacgccctgatagttattttcaggcgtct gagtcaaaagcacctgttgtaactcaaagatatgatgctaaatctcaattagatttaaga acaaaataa

DBGET integrated database retrieval system