Polyergus mexicanus: 138933047 Help Entry 138933047         CDS       T10742                                  Symbol Syb Name (RefSeq) synaptobrevin-1   KO K13504   vesicle-associated membrane protein 2 Organism pmec  Polyergus mexicanus Pathway pmec04130   SNARE interactions in vesicular transport pmec04145   Phagocytosis Brite KEGG Orthology (KO) [BR:pmec00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04130 SNARE interactions in vesicular transport     138933047 (Syb)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     138933047 (Syb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmec04131]     138933047 (Syb) Membrane trafficking [BR:pmec04131]  SNARE   VAMP, Ykt6, Sec22 (R)    VAMP     138933047 (Syb)  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab associated proteins     138933047 (Syb) SSDB OrthologParalogGFIT Motif Pfam:  Synaptobrevin MCU CD34_antigen YxzE DUF5345 ODV-E18 TMEM154 Orf78 DUF2207_C DUF6584 Sigma_reg_N ASG7 LMBR1 Tweety Pex24p Seryl_tRNA_N TMEM132_C Motif Other DBs NCBI-GeneID:  138933047 NCBI-ProteinID:  XP_070151595 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MEGGGVGEGEMGGPRNNQQAGASKKLQQTQATVEEVVGIMKVNVEKVLERDQKLSELENR ADALQQGATQFEQHAGKLKRKYWWKNLKMMIIIGIICVVILIIIIASVVPSSSSDSNDNA PK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggaaggtggcggtgtaggagaaggagaaatgggtggacctcgaaacaatcagcaagca ggagcgagcaaaaagttgcagcaaacgcaagcaaccgtggaagaggttgtaggtataatg aaagttaacgtggagaaggtattggagagagatcagaaactctcggagcttgagaatcgc gctgacgccctgcagcaaggcgcaacgcagttcgagcaacacgctggaaagttgaaacga aaatattggtggaagaatctcaaaatgatgattattattggtatcatctgcgtcgtcatc ttaataatcatcattgcttcggttgtaccaagttcgtcttcggacagcaatgataatgct ccaaaatga

DBGET integrated database retrieval system