Polyergus mexicanus: 138936217 Help Entry 138936217         CDS       T10742                                  Symbol Dlc90f Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism pmec  Polyergus mexicanus Pathway pmec04145   Phagocytosis pmec04814   Motor proteins Brite KEGG Orthology (KO) [BR:pmec00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     138936217 (Dlc90f)   09142 Cell motility    04814 Motor proteins     138936217 (Dlc90f)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pmec03037]     138936217 (Dlc90f)    04812 Cytoskeleton proteins [BR:pmec04812]     138936217 (Dlc90f) Cilium and associated proteins [BR:pmec03037]  Motile cilia and associated proteins   Dynein arm    138936217 (Dlc90f) Cytoskeleton proteins [BR:pmec04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      138936217 (Dlc90f) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 PTP2 DUF7917 Motif Other DBs NCBI-GeneID:  138936217 NCBI-ProteinID:  XP_070157531 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MEDAQEELQFVVDDVSNIIKEAIEVSIGGNAYQHNKVNQWTSNVVEACLGNLTKLQKAYK YIVTCTIMQKNGAGLHTASSCYWDNATDGSCTVRWENKTMYCIVSVFGLAL NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaggatgcacaagaagagttacaatttgtggtagatgatgtaagcaacattatcaaa gaagcgattgaggtatcaataggaggcaatgcatatcagcataataaagttaatcaatgg acctcaaatgttgtagaggcatgtttaggcaatcttacaaaattacagaaggcttacaaa tatattgtaacttgtacaatcatgcaaaaaaacggagctgggcttcataccgcgagctca tgttactgggataatgctactgatggaagctgtacggtacgttgggaaaataaaactatg tattgcattgtgtccgttttcggactggcgctttag

DBGET integrated database retrieval system