Polyergus mexicanus: 138939966 Help Entry 138939966         CDS       T10742                                  Symbol Urm1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism pmec  Polyergus mexicanus Pathway pmec04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:pmec00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     138939966 (Urm1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:pmec03016]     138939966 (Urm1)    04121 Ubiquitin system [BR:pmec04121]     138939966 (Urm1) Transfer RNA biogenesis [BR:pmec03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     138939966 (Urm1) Ubiquitin system [BR:pmec04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    138939966 (Urm1) SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  138939966 NCBI-ProteinID:  XP_070164460 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MSSSVAALSLTVEFGGGAELLFDKKKRHELDLPGNEWNLKRLLFWLRDNLLTERPELFMQ GDTVRPGILILVNDADWELLGEGDYKLCPRDRVLFISTLHGG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgagtgtcgctgcattatctctcactgtcgaatttgggggtggggcggaatta ctgttcgataagaaaaagagacacgagctggacttacctggaaatgaatggaacttgaaa cgattgctgttttggttacgagataatcttctgacggagcggccggagctcttcatgcaa ggtgatacggtgagaccgggtattctgattctggtaaacgacgccgactgggaattgttg ggtgaaggcgattataaactgtgtccgcgggacagggtgctcttcatctcgacactgcat ggagggtag

DBGET integrated database retrieval system