Polyergus mexicanus: 138940482 Help Entry 138940482         CDS       T10742                                  Name (RefSeq) translocase of outer membrane 7   KO K17771   mitochondrial import receptor subunit TOM7 Organism pmec  Polyergus mexicanus Pathway pmec04137   Mitophagy - animal Brite KEGG Orthology (KO) [BR:pmec00001]  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     138940482  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmec04131]     138940482    03029 Mitochondrial biogenesis [BR:pmec03029]     138940482   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pmec02000]     138940482 Membrane trafficking [BR:pmec04131]  Autophagy   Mitophagy    Other mitophagy associated  proteins     138940482 Mitochondrial biogenesis [BR:pmec03029]  Mitochondrial protein import machinery   Outer membrane    Transporter outer membrane (TOM) complex     138940482 Transporters [BR:pmec02000]  Other transporters   Primary active transporters [TC:3]    138940482 SSDB OrthologParalogGFIT Motif Pfam:  Tom7 Motif Other DBs NCBI-GeneID:  138940482 NCBI-ProteinID:  XP_070165524 LinkDB All DBs Position Unknown AA seq 54 aa AA seqDB search MSLNPTTKQRIAIVLDVSKFVFQWGFIPAVLFLGFRKGADPGMPELTLMNLLWQ NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgagtttaaatccgaccacaaaacaaagaatagccattgttttggacgtaagcaaattt gtgtttcaatggggctttattcccgctgtcctcttcttaggattcagaaaaggtgcagac ccaggcatgcctgaattaactcttatgaatttattgtggcagtaa

DBGET integrated database retrieval system