Pseudomonas mediterranea: E3Z27_15505 Help Entry E3Z27_15505       CDS       T08284                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmed  Pseudomonas mediterranea Pathway pmed01100   Metabolic pathways pmed01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmed00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E3Z27_15505    00074 Mycolic acid biosynthesis     E3Z27_15505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E3Z27_15505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QHA82975 LinkDB All DBs Position complement(3582145..3582402) Genome browser AA seq 85 aa AA seqDB search MSTQSLQALVLDLLASTLELDITEMDVQLSVEELGLDSLDVLKLTYAIEKRFGVNLSAYS HTDISSVHRLVEILAEQLSTQRAVS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgcaatcgctgcaagcactggtattggatctactggccagcaccctggaactg gatatcacggagatggacgtccaactgagcgtggaagagctggggctcgactcgctggac gtgttgaagctgacttacgcgattgaaaagcgctttggcgtcaatctctctgcctacagc cataccgacatcagttcagtgcatcgcctggtggaaatattggccgaacagttgtccacc cagcgagccgtttcgtga

DBGET integrated database retrieval system