Pseudomonas mediterranea: E3Z27_25310
Help
Entry
E3Z27_25310 CDS
T08284
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
pmed
Pseudomonas mediterranea
Pathway
pmed03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
pmed00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
E3Z27_25310 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
pmed03011
]
E3Z27_25310 (rplR)
Ribosome [BR:
pmed03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
E3Z27_25310 (rplR)
Bacteria
E3Z27_25310 (rplR)
Archaea
E3Z27_25310 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
TGS
Motif
Other DBs
NCBI-ProteinID:
QHA84736
LinkDB
All DBs
Position
complement(5797623..5797973)
Genome browser
AA seq
116 aa
AA seq
DB search
MTDKKVTRLRRARKARLKMHELEVVRLCVFRSSQHIYAQVISADGNKVLASASTLDKELR
DGATGNIDAATKVGQLVATRAKAAGVSQVAFDRSGFKYHGRVKALADAAREAGLEF
NT seq
351 nt
NT seq
+upstream
nt +downstream
nt
atgaccgacaaaaaagttactcgactgcgtcgcgctcgcaaagcacgcctgaaaatgcac
gaactcgaagtcgtgcgtctctgcgtgttccgctcttcgcagcacatctacgcccaggtc
atttcggccgacggcaacaaggtcctggcaagtgcctcgactttggataaagaactgcgt
gatggtgccaccggcaacatcgacgcggccactaaggttggccagctggtcgctacgcgt
gctaaagccgctggcgtctcgcaggtggctttcgaccgctctggcttcaagtaccacggc
cgcgtcaaggcgctggctgatgctgctcgtgaagctgggctggagttctaa
DBGET
integrated database retrieval system