Paraburkholderia megapolitana: FNZ07_02785 Help Entry FNZ07_02785       CDS       T06515                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism pmeg  Paraburkholderia megapolitana Brite KEGG Orthology (KO) [BR:pmeg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmeg03036]     FNZ07_02785    03400 DNA repair and recombination proteins [BR:pmeg03400]     FNZ07_02785 Chromosome and associated proteins [BR:pmeg03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FNZ07_02785 DNA repair and recombination proteins [BR:pmeg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       FNZ07_02785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS NNMT_PNMT_TEMT GerA Motif Other DBs NCBI-ProteinID:  QDQ80179 LinkDB All DBs Position 1:complement(649454..649708) Genome browser AA seq 84 aa AA seqDB search MKQQAEQQVLDFDGQARERLIQWIRNRMEEFDITMEVLEAALIAEAARPKYRDAFGNRWD GQGERPDWLRRAINAGQDIEHFRC NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaaacaacaagcggaacaacaggtactggatttcgacgggcaggcgcgcgagcggctg atccagtggatccggaatcgcatggaagagttcgacatcacgatggaagtcctggaagcg gcgcttatcgccgaagcagccaggccgaaatatcgcgatgcgtttggcaaccgctgggat ggtcagggcgagcggcccgactggttgcgacgggcgatcaatgcggggcaggacatcgaa cactttcggtgctga

DBGET integrated database retrieval system