Paraburkholderia megapolitana: FNZ07_22560 Help Entry FNZ07_22560       CDS       T06515                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pmeg  Paraburkholderia megapolitana Brite KEGG Orthology (KO) [BR:pmeg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pmeg03032]     FNZ07_22560    03036 Chromosome and associated proteins [BR:pmeg03036]     FNZ07_22560    03400 DNA repair and recombination proteins [BR:pmeg03400]     FNZ07_22560 DNA replication proteins [BR:pmeg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FNZ07_22560 Chromosome and associated proteins [BR:pmeg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FNZ07_22560 DNA repair and recombination proteins [BR:pmeg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FNZ07_22560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 UBA_HYPK HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QDQ83925 LinkDB All DBs Position 2:2041823..2042095 Genome browser AA seq 90 aa AA seqDB search MNKTELIDHIAQQADISKAAAGRALDAVIGGVKGTLKTGGSVTLVGFGTFAVGKRTARTG RNPRTGAAIKIKAAKVPKFKPGKALKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacggaattgatcgaccatattgcgcagcaagccgacatctccaaagcagcg gcgggacgcgcgctcgatgcggtgatcggcggtgtcaaagggacattgaaaacgggcggt tcggtcacgctggtcggcttcggtacgttcgccgtgggcaaacgtaccgcgcgtaccggg cgcaatccgcgcacgggcgccgcgatcaagatcaaggccgccaaggtacccaaatttaag cctggcaaggcactgaaagatgcgctaaactag

DBGET integrated database retrieval system