Paraburkholderia megapolitana: FNZ07_28225 Help Entry FNZ07_28225       CDS       T06515                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmeg  Paraburkholderia megapolitana Pathway pmeg00998   Biosynthesis of various antibiotics pmeg01100   Metabolic pathways pmeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FNZ07_28225    00074 Mycolic acid biosynthesis     FNZ07_28225   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FNZ07_28225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  QDQ84933 LinkDB All DBs Position 2:complement(3351500..3351751) Genome browser AA seq 83 aa AA seqDB search MTDAEILERIRAIFNENFAIEPERVTPDANLFEDLDLDSIDAVDLAIKLQEMTGRRIKPD EFKSVRTVSDVIRAVESLLAAQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgaccgatgcagagattcttgagcgtattcgcgccatcttcaacgagaacttcgcgatc gaaccagagcgtgtgacgcccgatgcaaacctgttcgaagatctcgatctcgacagcatc gatgcagtcgacctcgcgatcaagctgcaggaaatgaccggtcgccgcatcaagccggac gagttcaaatcagtgcgtacggtcagcgatgtgatccgcgcagtcgaatcgctgctcgca gcgcagggctga

DBGET integrated database retrieval system